Recombinant Cellvibrio japonicus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for precise delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
yidC; CJA_3823; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)
Target Names
yidC
Target Protein Sequence
MDWQKNLLLAAIAAVILMLFIRWNHFQEQLPQHQAGNTPAGSSIAAIAPDSNGDIPSAVP TASDTPQATADSSKVELIQVKTDNLLVTINPLGGDIASVSLPRHFAKLNTPDEPFVLLDN RNNHTYVSQSGLIGTNGTDTAQGRPLFNSSSTSYELKEGSDGLVVDLTLQQGAVNITKRF SFKRGDYLIGVEYLIDNQAETPWSAQLYGQIKRDSQNFVKVSALEMNPYLGAAITTSEEN YKKIHFEDIAKQTFETSRQGGWVAMVQHYFISAWIPDASSQVNYKLRKLGDQDLYLLGFT TQPVVVEPGSKGVIKASFYAGPKDTERLEEISPYLDLTVDYGWLWWIAKPLFAFLKFIHG FLGNWGLAIIGLTLSVKLLFFPLSAASYRSMAKMRKLQPKLLELKERYGEDRQKFSQEMM KLYKTEQVNPFGGCLPLLIQMPVFIALYWVLMESVELRHAPFFGWIEDLSRMDPYFVLPI IYGATMWIMQKLNPQPTDPMQARIMNMLPFVFTFMFLWFPAGLVLYWVTNNLLSIAQQYV ITRQIERADSKA
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cellvibrio japonicus and why is it significant for YidC research?

Cellvibrio japonicus is a saprophytic bacterium isolated in 1948 from soil in Saitama Prefecture, Japan. It is a Gram-negative, non-spore forming, rod-shaped bacterium that is motile via one polar flagellum. The bacterium is primarily aerobic with an optimal growth temperature of 30°C and pH optimum of 7.5 . Its significance for YidC research stems from its exceptional capacity for environmental polysaccharide degradation, possessing an impressive array of carbohydrate-active enzymes (CAZymes) that make it a potential platform for biotechnological applications. While YidC has been extensively studied in other bacterial models, investigating its function in a polysaccharide utilization specialist like C. japonicus could provide unique insights into membrane protein insertion mechanisms in bacteria adapted to complex substrate degradation environments.

How does YidC function as a membrane protein insertase?

YidC functions as a membrane protein insertase by facilitating the integration of proteins into the cytoplasmic membrane, either independently or in concert with the SecY complex. The structural model of YidC reveals a distinctive arrangement of five conserved transmembrane domains and a helical hairpin between transmembrane segments 2 and 3 on the cytoplasmic membrane surface . During co-translational membrane protein insertion, a single YidC monomer interacts with the ribosome at the ribosomal tunnel exit, creating a site for membrane protein insertion at the YidC protein-lipid interface . YidC recognizes and binds ribosome-exposed nascent chains early in translation, with binding efficiency reaching maximum levels once the nascent transmembrane domain is fully exposed outside the ribosomal tunnel . This mechanism allows for the direct partitioning of hydrophobic nascent chains into the membrane during protein synthesis.

What is the genomic context of YidC in Cellvibrio japonicus?

Cellvibrio japonicus possesses a 4.5 Mb genome with a G+C content of 52%, predicted to encode approximately 3790 proteins, with about 66% having assigned cellular functions . While the search results don't specifically detail the genomic context of YidC in C. japonicus, the bacterium's genome contains one Tn3 and one Tn7 transposon, along with a single 4.7 kb CRISPR array. The genome encodes numerous carbohydrate-active enzymes, including 130 predicted glycoside hydrolases, 46 glycoside transferases, 14 polysaccharide lyases, 16 carbohydrate esterases, two lytic polysaccharide monooxygenases (LPMOs), and 17 carbohydrate-binding module-containing proteins without assigned functions . The YidC gene would likely be among the essential genes involved in membrane protein biogenesis, similar to its homologs in other Gram-negative bacteria.

What are the recommended protocols for expressing recombinant YidC from Cellvibrio japonicus?

For expressing recombinant YidC from Cellvibrio japonicus, researchers can adapt protocols previously described for YidC variants from other bacterial species. Based on the methodologies mentioned in the literature, the following approach is recommended:

  • Gene Cloning and Vector Construction:

    • Amplify the C. japonicus YidC gene using PCR with specific primers

    • Clone into an expression vector with an appropriate tag (His-tag frequently used)

    • Include a strong promoter (T7 or similar) for controlled expression

  • Expression Conditions:

    • Transform into E. coli expression strains (BL21(DE3) or derivatives)

    • Grow cultures at 30°C (matching C. japonicus optimal temperature)

    • Induce with IPTG at low concentrations (0.1-0.5 mM) when OD600 reaches 0.6-0.8

    • Continue expression at lower temperatures (16-20°C) for 4-16 hours to enhance proper folding

  • Purification Strategy:

    • Extract membrane proteins using detergents (DDM, LDAO)

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Optionally reconstitute into lipid nanodiscs for functional studies

The expression and purification should be validated using SDS-PAGE and Western blotting to confirm protein integrity and purity.

How can researchers effectively reconstitute purified YidC into lipid bilayers for functional studies?

Effective reconstitution of purified YidC into lipid bilayers for functional studies can be achieved through several approaches:

  • Nanodisc Reconstitution:

    • Mix purified YidC with MSP (membrane scaffold protein) and lipids at specific ratios

    • Remove detergent using polystyrene beads or dialysis

    • Purify YidC-nanodiscs using size exclusion chromatography

    • This method provides a native-like membrane environment while maintaining water solubility

  • Liposome Incorporation:

    • Prepare liposomes using E. coli lipid extracts or defined lipid mixtures

    • Mix with detergent-solubilized YidC

    • Remove detergent gradually using Bio-Beads or dialysis

    • Separate proteoliposomes by centrifugation

  • Quality Control Methods:

    • Verify insertion using protease protection assays

    • Confirm orientation using antibody accessibility tests

    • Assess oligomeric state using crosslinking and analytical ultracentrifugation

  • Functionality Assessment:

    • Monitor ribosome binding using microscale thermophoresis or fluorescence techniques

    • Evaluate membrane protein insertion using in vitro translation systems coupled with proteoliposomes

    • Measure conformational dynamics using site-specific fluorescence labels

These approaches enable researchers to study YidC in environments that closely mimic its native membrane context, providing insights into its structure-function relationships.

What techniques are used to study YidC-ribosome interactions?

Multiple complementary techniques are used to study YidC-ribosome interactions:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of YidC-ribosome complexes at near-atomic resolution

    • Allows identification of interaction sites at the ribosomal tunnel exit

    • Reveals conformational changes in YidC upon nascent chain binding

  • Fluorescence-Based Methods:

    • Fluorescence resonance energy transfer (FRET) to measure distances between labeled components

    • Site-specific labeling of YidC and ribosomal proteins to monitor dynamic interactions

    • Microscale thermophoresis to quantify binding affinities and kinetics

  • Biochemical Approaches:

    • Ribosome binding assays using purified components

    • Co-sedimentation assays to isolate stable complexes

    • Crosslinking studies to identify specific interaction sites

    • Surface plasmon resonance for real-time interaction measurements

  • Molecular Dynamics Simulations:

    • Computational modeling of YidC-ribosome interfaces

    • Analysis of inter-residue interactions and stability

  • Genetic Approaches:

    • Mutagenesis of key residues followed by functional assays

    • In vivo complementation assays to validate the importance of specific interactions

The combination of these techniques provides a comprehensive understanding of how YidC recognizes ribosomes and facilitates the insertion of nascent membrane proteins into the lipid bilayer.

How does the structure of Cellvibrio japonicus YidC compare to YidC homologs in other bacteria?

A comparative analysis of C. japonicus YidC with its homologs would likely reveal both conserved and species-specific features:

FeatureC. japonicus YidC (predicted)E. coli YidCOther bacterial YidC homologs
Core structure5 transmembrane domains5 transmembrane domains5 transmembrane domains
C-terminal domainLikely positively chargedPositively charged (ribosome binding)Variable length and charge
Helical hairpinBetween TM2 and TM3Between TM2 and TM3Conserved position
Hydrophobic coreSubstrate binding siteHydrophobic groove for substrate insertionSimilar hydrophobic regions
Size~500-550 amino acids (predicted)548 amino acidsVariable (500-600 aa)

While the exact structure of C. japonicus YidC has not been explicitly determined in the provided search results, structural models of YidC from other bacteria suggest a highly conserved arrangement of five transmembrane domains with a helical hairpin between TM2 and TM3 on the cytoplasmic surface . The model derived from evolutionary co-variation analysis and molecular dynamics simulations shows how YidC interacts with the ribosome at the tunnel exit and identifies a site for membrane protein insertion at the YidC protein-lipid interface. Key residues involved in ribosome binding and substrate interaction are likely conserved, including the positively charged C-terminus that facilitates ribosome interaction .

What is the relationship between YidC and the SecYEG translocon in Cellvibrio japonicus?

While the specific relationship between YidC and SecYEG in Cellvibrio japonicus is not explicitly described in the search results, we can infer likely interactions based on conserved functions across bacteria:

  • Functional Cooperation:

    • YidC likely works both independently and in concert with the SecYEG complex in C. japonicus

    • For certain substrates, YidC probably associates with the SecYEG translocon to form a holotranslocon

    • This cooperation facilitates the insertion of complex membrane proteins with multiple transmembrane domains

  • Substrate Specificity:

    • YidC alone typically handles simpler membrane proteins with fewer transmembrane segments

    • SecYEG-dependent substrates include proteins with complex topology or large periplasmic domains

    • The SecYEG-YidC pathway likely inserts proteins that require both systems for proper folding

  • Evolutionary Conservation:

    • The YidC/Oxa1/Alb3 family is universally conserved across bacteria, mitochondria, and chloroplasts

    • This conservation suggests that C. japonicus YidC maintains core functions similar to those in other bacteria

    • The interaction network with SecYEG is likely preserved due to its essential role in membrane protein biogenesis

Given C. japonicus' specialization in polysaccharide degradation, it might have evolved specific adaptations in its membrane protein insertion machinery to accommodate the numerous transporters and enzymes required for its lifestyle, but the core YidC-SecYEG relationship is likely preserved.

How do the conformational dynamics of YidC change during membrane protein insertion?

The conformational dynamics of YidC during membrane protein insertion involve several key changes:

  • Structural Rearrangements:

    • Upon nascent chain interaction, YidC undergoes significant conformational changes

    • The essential transmembrane domains 2 and 3 tilt to accommodate the substrate

    • The amphipathic helix EH1 relocates into the hydrophobic core of the membrane

  • Hydrophobic Groove Formation:

    • Molecular dynamics simulations reveal that YidC forms a hydrophobic groove at the protein-lipid interface

    • This groove creates a protected environment for nascent transmembrane domains

    • The arrangement of TM helices creates a path of least resistance for substrate insertion into the lipid bilayer

  • Ribosome Interaction Effects:

    • Ribosome binding to the C-terminus of YidC causes allosteric changes in the transmembrane region

    • These changes prepare the insertase to receive the nascent chain

    • The positively charged C-terminus and the short cytoplasmic loop connecting TM4 and TM5 facilitate ribosome interaction

  • Substrate-Dependent Adaptations:

    • Different substrates induce distinct conformational states in YidC

    • The flexibility of YidC allows it to accommodate various transmembrane domain sequences and topologies

    • Mutagenesis studies have identified key residues like T362 in TM2 and Y517 in TM6 that are critical for YidC function

These dynamic changes allow YidC to function efficiently as a membrane protein insertase, guiding hydrophobic segments from the ribosome exit tunnel directly into the lipid bilayer.

How does YidC contribute to the assembly of polysaccharide-degrading machinery in Cellvibrio japonicus?

YidC likely plays a crucial role in assembling the extensive polysaccharide-degrading machinery of Cellvibrio japonicus, though specific details are not provided in the search results:

  • Insertion of Transport Systems:

    • C. japonicus possesses numerous TonB-dependent transporters for polysaccharide import

    • YidC would be essential for inserting these membrane transport proteins

    • Proper assembly of these transporters is crucial for C. japonicus to remain competitive in environments rich in polysaccharides

  • Secretion System Assembly:

    • C. japonicus utilizes a Type II Secretion System for exporting its numerous CAZymes

    • YidC likely participates in assembling the membrane components of this secretion system

    • This system has been shown to be essential for the export of C. japonicus CAZymes

  • Membrane-Associated Enzyme Integration:

    • Some CAZymes may be membrane-associated or contain transmembrane anchors

    • YidC would facilitate the proper integration of these enzymes into the bacterial membrane

    • This proper integration ensures enzymes are correctly positioned for substrate access

  • Coordination with Substrate-Specific Regulation:

    • C. japonicus regulates CAZyme-encoding genes primarily via substrate detection

    • Membrane-embedded sensor proteins involved in this regulation likely require YidC for insertion

    • These sensors would be crucial for the bacterium's ability to detect and respond to available polysaccharides

Given C. japonicus' specialization in polysaccharide degradation and its possession of 130 predicted glycoside hydrolases and numerous other CAZymes, YidC's role in assembling the membrane components of this machinery would be essential for the bacterium's lifestyle.

What insights can be gained from studying Cbp2D-LPMO interactions in relation to YidC function?

Studying Cbp2D-LPMO interactions in Cellvibrio japonicus can provide valuable insights into YidC function through several connections:

  • Redox Protein Assembly Pathways:

    • Cbp2D contains a small c-type cytochrome (CjX183) that functions as an electron donor to LPMOs

    • The proper membrane localization of such redox-active proteins likely requires YidC

    • Understanding how these complexes assemble could reveal YidC's role in organizing redox chains in the membrane

  • Co-factor Incorporation During Insertion:

    • CjX183 requires proper heme incorporation for function

    • YidC may coordinate with other machinery to ensure cofactor incorporation during membrane protein insertion

    • This provides insights into how YidC handles complex membrane proteins with cofactor requirements

  • Membrane Protein Complex Formation:

    • The interaction between Cbp2D and LPMOs represents a model for membrane protein-enzyme interactions

    • YidC likely facilitates the arrangement of such protein complexes in the membrane

    • Studying these interactions can reveal principles of how YidC positions proteins for optimal functional interactions

  • Experimental Data on Electron Transfer Systems:

    • CjX183-driven reduction of LPMOs results in less H₂O₂ production and less oxidative damage compared to ascorbate

    • This suggests precisely controlled electron transfer systems that depend on proper membrane organization

    • YidC's role in organizing these systems could be critical for preventing oxidative damage during polysaccharide degradation

These connections highlight how studying the specialized redox systems in C. japonicus can provide broader insights into YidC's role in assembling complex membrane protein machinery beyond simple transmembrane domain insertion.

How does the membrane composition of Cellvibrio japonicus affect YidC-mediated protein insertion?

The membrane composition of Cellvibrio japonicus likely influences YidC-mediated protein insertion in several important ways:

  • Lipid Phase Effects on Insertion Efficiency:

    • Studies on YidC have shown that it can efficiently catalyze membrane insertion of nascent transmembrane domains in both fluid and gel phase membranes

    • This property would be particularly important for C. japonicus, which may experience various environmental conditions that affect membrane fluidity

    • The bacteria's optimal growth temperature of 30°C and tolerance to 3% (w:v) NaCl suggest adaptations in membrane composition that YidC must work with

  • Protein-Lipid Interface Dynamics:

    • Molecular dynamics simulations of YidC reveal specific lipid-protein interactions that stabilize its structure

    • Hydrophobic residues on the exterior of the TM bundle stabilize interactions with the apolar lipid tails

    • The composition of C. japonicus membranes would influence these interactions and potentially the conformational flexibility of YidC

  • Membrane Protein Stability Factors:

    • Key residues in YidC interact differently with the membrane environment

    • Residues toward the cytoplasmic side are primarily polar or charged and engage in electrostatic interactions

    • Residues on the periplasmic side are primarily aromatic and involved in stacking and nonpolar dispersion interactions

    • These interactions would be modulated by C. japonicus-specific membrane composition

  • Adaptation to Ecological Niche:

    • As a soil bacterium specialized in polysaccharide degradation, C. japonicus likely has membrane adaptations for its ecological niche

    • These adaptations would influence how YidC functions in inserting the numerous transporters and enzymes required for the bacterium's lifestyle

    • Understanding these adaptations could provide insights into how YidC function is optimized for specific bacterial lifestyles

While specific data on C. japonicus membrane composition is not provided in the search results, these principles highlight the importance of considering membrane context when studying YidC-mediated protein insertion in this specialized bacterium.

What are the key challenges in expressing active recombinant YidC from Cellvibrio japonicus?

Several significant challenges exist in expressing active recombinant YidC from Cellvibrio japonicus:

  • Membrane Protein Expression Barriers:

    • Overexpression of membrane proteins often leads to toxicity in host cells

    • Inclusion body formation can occur due to misfolding or aggregation

    • Limited membrane space in expression hosts can restrict proper insertion

  • C. japonicus-Specific Challenges:

    • Potential codon usage differences between C. japonicus and common expression hosts

    • Requirements for specific lipid environments that match C. japonicus membranes

    • Possible need for C. japonicus-specific chaperones or assembly factors

  • Functional Assessment Complexities:

    • Difficulty in establishing reliable activity assays for YidC function

    • Need for compatible substrates from C. japonicus to test insertion activity

    • Challenges in reconstituting interactions with C. japonicus-specific partners

  • Structural Stability Concerns:

    • Maintaining the native conformation during extraction and purification

    • Selecting appropriate detergents that preserve YidC structure and function

    • Preventing aggregation or misfolding during reconstitution into membrane mimetics

  • Technical Approaches to Address Challenges:

    • Use of specialized expression strains with enhanced membrane protein production capacity

    • Codon optimization of the C. japonicus YidC gene

    • Fusion with solubility-enhancing tags that can be later removed

    • Controlled expression conditions (lower temperature, mild induction)

    • Screening multiple detergents for optimal extraction and stability

Overcoming these challenges would enable detailed structural and functional studies of C. japonicus YidC and its role in the bacterium's specialized polysaccharide degradation lifestyle.

How might genetic engineering of YidC improve recombinant protein expression in Cellvibrio japonicus?

Genetic engineering of YidC could significantly improve recombinant protein expression in Cellvibrio japonicus through several strategic approaches:

  • Enhanced Membrane Protein Production Capacity:

    • Controlled overexpression of YidC could increase the membrane protein folding capacity

    • Engineering YidC variants with improved substrate recognition for specific recombinant proteins

    • Creating fusions with additional chaperone domains to enhance folding efficiency

  • Substrate Specificity Modifications:

    • Targeted mutations in the hydrophobic groove could optimize insertion of specific recombinant membrane proteins

    • Engineering the ribosome-binding domain to enhance co-translational insertion efficiency

    • Modifying residues at the protein-lipid interface to accommodate diverse substrate properties

  • Stress Response Integration:

    • Coupling YidC expression to cellular stress responses to dynamically adjust capacity

    • Engineering feedback mechanisms that detect membrane protein folding bottlenecks

    • Creating synthetic regulatory circuits that coordinate YidC levels with recombinant protein expression

  • Multi-component System Optimization:

    • Co-engineering YidC and SecYEG components for improved holotranslocon function

    • Optimizing interactions with C. japonicus-specific chaperones and folding factors

    • Creating synthetic membrane protein insertion modules tailored to specific recombinant proteins

  • Potential Outcomes and Benefits:

    • Higher yields of correctly folded membrane proteins for biotechnology applications

    • Improved production of challenging membrane-associated CAZymes and transporters

    • Enhanced secretion of enzymes through better insertion of secretion system components

    • Development of C. japonicus as a specialized expression host for carbohydrate-active enzymes

These approaches could transform C. japonicus into a more effective platform for expressing complex membrane proteins, particularly those involved in polysaccharide degradation and transport, leveraging its natural capabilities as a carbohydrate-bioconversion specialist.

What is the potential for developing Cellvibrio japonicus as a synthetic biology platform for membrane protein studies?

Cellvibrio japonicus shows considerable promise as a synthetic biology platform for membrane protein studies:

  • Natural Advantages for Biotechnology Applications:

    • C. japonicus is naturally adept at environmental polysaccharide degradation, making it valuable for biomass conversion

    • Its robust CAZyme systems provide a foundation for engineering enhanced lignocellulose processing

    • The bacterium represents a carbohydrate-bioconversion specialist with potential for producing renewable fuels and chemicals

  • Genetic Tool Development Status:

    • Steady progress has been made in developing genetic tools for C. japonicus

    • These tools enable better understanding of the function and regulation of its polysaccharide-degrading enzymes

    • The existing genetic toolkit provides a foundation for synthetic biology applications

  • Membrane Protein Expression Capabilities:

    • C. japonicus naturally expresses a vast array of TonB-dependent transporters

    • This suggests an inherent capacity for producing diverse membrane proteins

    • The bacterium's membrane composition may be advantageous for certain classes of membrane proteins

  • Integration with Bioenergy Applications:

    • C. japonicus-based platforms could combine membrane protein production with biomass processing

    • Engineered strains could express both specialized CAZymes and novel membrane transporters

    • This integration could create multifunctional cellular factories for bioenergy applications

  • Potential Research Applications:

    • Study of membrane protein insertion mechanisms in non-model organisms

    • Investigation of specialized transport systems for complex carbohydrates

    • Development of membrane-associated enzyme systems for in situ biomass conversion

    • Creation of cell-surface display technologies utilizing YidC-mediated insertion

The unique combination of C. japonicus' natural polysaccharide degradation capabilities and the ongoing development of genetic tools makes it a promising candidate for specialized membrane protein studies, particularly those related to carbohydrate transport and processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.