Recombinant Cellvibrio japonicus Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nqrE; CJA_1769; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)
Target Names
nqrE
Target Protein Sequence
MEHLLSLLVRSVFIENMALAFFLGMCSFLAMSKKINAAIGLGIAVIVVQTVTVPANNLLL TYLLKEDALAWAGVTGVDLTFLSFISFIGVIAAIVQIMEMVMDKYMPALYNALGVFLPLI TVNCVIMGGSLFMVERDYHFAESVVYGFGSGAGWAIAIVLLAGILEKMKYSDIPEGLRGL GITFITVGLMSLGFMSFGGISL
Uniprot No.

Target Background

Function

The Na+-translocating NADH-quinone reductase (NQR) complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol. This process is coupled with the transport of Na+ ions from the cytoplasm to the periplasm. Subunits NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase subunit E in Cellvibrio japonicus?

Na(+)-translocating NADH-quinone reductase subunit E (NqrE) is one of the essential components of the Na(+)-NQR complex in Cellvibrio japonicus. This protein belongs to the respiratory chain and participates in energy generation through the translocation of sodium ions across the cellular membrane. The protein is encoded by the nqrE gene (CJA_1769 in the Ueda107 strain) and functions as part of a multisubunit complex involved in the bacterium's energy metabolism pathway . Within the context of Cellvibrio japonicus, a bacterium renowned for its impressive polysaccharide-degrading capabilities, this energy-generating mechanism is crucial for supporting the metabolic demands of complex carbohydrate breakdown .

How does NqrE integrate into the bacterial membrane?

NqrE is a membrane-integrated protein with hydrophobic regions that anchor it within the lipid bilayer. Analysis of its amino acid sequence reveals multiple transmembrane domains characterized by stretches of hydrophobic residues. These domains form alpha-helical structures that span the membrane, positioning specific functional regions of the protein on either side of the membrane or within the lipid environment. This structural arrangement is essential for the protein's role in Na(+) translocation during the electron transport process. When working with recombinant NqrE, researchers must consider these membrane-integration properties for proper folding and function, particularly when designing experiments involving protein reconstitution in liposomes or membrane mimetics .

What expression systems are optimal for producing recombinant Cellvibrio japonicus NqrE?

For successful expression of recombinant Cellvibrio japonicus NqrE, several expression systems can be utilized, with E. coli being the most commonly employed host. When expressing membrane proteins like NqrE, consider these methodological approaches:

E. coli expression system optimization:

  • Use C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Employ low temperature induction (16-20°C) to reduce inclusion body formation

  • Utilize tightly controlled promoters (T7lac or ara) to prevent toxic effects of membrane protein overexpression

  • Supplement growth media with specific lipids to support proper membrane insertion

The choice of fusion tags can significantly impact both expression and subsequent purification. A polyhistidine tag (His-tag) at either the N-terminus or C-terminus facilitates purification via immobilized metal affinity chromatography (IMAC). For NqrE specifically, the tag placement should avoid disrupting the membrane-spanning domains, which are critical for proper folding .

What purification strategies yield the highest purity and activity of recombinant NqrE?

Purification of membrane proteins like NqrE requires specialized approaches:

Recommended purification workflow:

  • Membrane fraction isolation:

    • Lyse cells via sonication or French press in buffer containing protease inhibitors

    • Separate membrane fraction through ultracentrifugation (typically 100,000 × g for 1 hour)

    • Solubilize membranes using appropriate detergents

  • Detergent selection is critical:

    • Initial screening should include mild detergents like n-dodecyl-β-D-maltoside (DDM), n-decyl-β-D-maltoside (DM), or digitonin

    • Detergent concentration should be optimized to minimize protein denaturation while ensuring efficient solubilization

  • Chromatography sequence:

    • IMAC as the initial capture step for His-tagged NqrE

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Optional ion exchange chromatography for removing contaminants with different charge properties

  • Buffer optimization:

    • Include glycerol (10-20%) to stabilize the protein structure

    • Maintain detergent concentration above critical micelle concentration

    • Consider including lipids to stabilize the native conformation

For storage, a buffer containing 50% glycerol has been shown to maintain NqrE stability when stored at -20°C, though repeated freeze-thaw cycles should be avoided .

How can researchers verify the proper folding and activity of recombinant NqrE?

Verification of proper folding and activity of recombinant NqrE requires multiple analytical approaches:

Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

  • Thermal shift assays to evaluate protein stability

  • Limited proteolysis to assess compact folding

Functional characterization:

  • Reconstitution into proteoliposomes to measure Na+ transport activity

  • NADH:quinone oxidoreductase activity assays using artificial electron acceptors

  • Measurement of Na+ transport using fluorescent sodium indicators

Complex assembly analysis:

  • Blue native PAGE to assess complex formation with other Na+-NQR subunits

  • Co-immunoprecipitation studies to verify subunit interactions

  • Cross-linking experiments to map interaction domains

When interpreting activity measurements, researchers should consider that the isolated NqrE subunit may show limited activity compared to the complete Na+-NQR complex, necessitating reconstitution approaches for comprehensive functional studies .

What structural features distinguish NqrE from other membrane subunits in the Na+-NQR complex?

NqrE possesses distinctive structural features that differentiate it from other Na+-NQR complex subunits:

Key structural characteristics:

  • Membrane topology: NqrE contains multiple transmembrane helices with a specific arrangement that facilitates ion translocation

  • Conserved motifs: Analysis of the amino acid sequence reveals motifs critical for Na+ coordination

  • Lipid interaction domains: Specific regions that interact with membrane phospholipids to maintain structural integrity

Comparative structural table of Na+-NQR subunits:

SubunitMolecular Weight (kDa)Number of Transmembrane HelicesCofactorsPrimary Function
NqrA~480 (peripheral)NoneNADH binding
NqrB~469FMN, Fe-SElectron transfer
NqrC~271FMNElectron transfer
NqrD~226NoneNa+ translocation
NqrE~216NoneNa+ translocation
NqrF~450 (peripheral)FAD, Fe-SQuinone reduction

Understanding these structural distinctions is essential for designing targeted mutagenesis studies and for developing specific inhibitors that might selectively affect NqrE function without disrupting other complex components .

How can site-directed mutagenesis be used to investigate critical residues in NqrE?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationship of NqrE in Cellvibrio japonicus. This technique allows for the precise alteration of specific amino acid residues to evaluate their contribution to protein function.

Methodological workflow for NqrE mutagenesis studies:

  • Target residue identification:

    • Analyze sequence conservation across bacterial species

    • Identify charged or polar residues within putative transmembrane domains

    • Focus on residues in predicted Na+ binding pockets

  • Mutagenesis strategy:

    • Conservative substitutions (e.g., Asp→Glu) to maintain charge but alter geometry

    • Charge neutralization (e.g., Asp→Asn) to assess electrostatic contributions

    • Charge reversal (e.g., Asp→Lys) to evaluate ionic interactions

  • Expression and activity assessment:

    • Heterologous expression in E. coli

    • Purification using standardized protocols for wild-type and mutant proteins

    • Functional reconstitution into liposomes

  • Comprehensive analysis of mutant phenotypes:

    • Na+ transport measurements

    • NADH oxidation kinetics

    • Complex assembly evaluation

Interpretation guidelines:

  • Residues critical for Na+ coordination typically show severe activity loss upon mutation

  • Residues involved in subunit interactions may permit complex assembly but impair activity

  • Residues maintaining structural integrity often lead to folding defects when mutated

This systematic approach allows researchers to generate a detailed functional map of NqrE, identifying residues that participate directly in ion translocation versus those that maintain structural integrity or mediate interactions with other subunits .

How does NqrE expression correlate with polysaccharide utilization in Cellvibrio japonicus?

Cellvibrio japonicus exhibits sophisticated regulatory mechanisms that coordinate energy metabolism with polysaccharide utilization. The expression of genes encoding components of the Na+-NQR complex, including nqrE, likely responds to both substrate availability and energetic demands.

Recent RNAseq analysis of Cellvibrio japonicus has revealed two distinct regulatory mechanisms governing carbohydrate utilization:

  • Substrate detection-controlled regulation: Genes directly involved in initial substrate recognition and degradation

  • Growth rate-dependent regulation: Genes involved in central metabolism and energy generation

Based on these regulatory patterns, the expression of nqrE likely falls into the growth rate-dependent category, increasing during rapid growth on preferred substrates and showing reduced expression during growth on more recalcitrant polysaccharides.

Experimental approaches to investigate nqrE regulation:

  • Time-course transcriptomics: Monitor nqrE expression across growth phases on different carbon sources

  • Reporter gene fusions: Construct nqrE promoter-reporter fusions to visualize expression patterns

  • Chromatin immunoprecipitation: Identify transcription factors binding to the nqrE promoter region

Understanding these regulatory connections provides insights into how Cellvibrio japonicus coordinates its impressive array of carbohydrate-active enzymes with energy-generating systems to efficiently utilize diverse polysaccharide substrates .

What functional differences might exist between NqrE in Cellvibrio japonicus and homologous proteins in other bacteria?

Comparative analysis of NqrE from Cellvibrio japonicus with homologous proteins from other bacteria reveals potential functional adaptations specific to each organism's ecological niche and metabolic requirements.

Cross-species comparison of NqrE:

When examining NqrE from Cellvibrio japonicus alongside the homologous protein from Pseudoalteromonas atlantica, several noteworthy differences emerge:

These differences likely reflect adaptations to specific environmental conditions:

  • Habitat specialization: C. japonicus, as a soil bacterium specialized in plant polysaccharide degradation, may have adapted its Na+-NQR complex to function optimally in environments with fluctuating sodium concentrations

  • Metabolic integration: The subtle differences in NqrE structure may reflect co-evolution with the unique metabolic capabilities of each organism

  • Temperature adaptation: Variations in membrane-spanning domains may represent adaptations to the preferred growth temperature of each organism

Researchers investigating NqrE function should consider these species-specific adaptations when extrapolating findings between bacterial systems .

What are the most common challenges in working with recombinant NqrE and how can they be addressed?

Working with membrane proteins like NqrE presents several technical challenges that researchers should anticipate and address:

Challenge 1: Low expression yields

  • Solution: Optimize codon usage for the expression host, reduce expression temperature to 16-20°C, and consider fusion partners like MBP that can enhance solubility

  • Alternative approach: Use cell-free expression systems supplemented with nanodiscs or liposomes

Challenge 2: Protein aggregation during purification

  • Solution: Screen multiple detergents at various concentrations; consider mixed micelle systems (e.g., DDM with cholesteryl hemisuccinate)

  • Stabilization strategy: Add specific lipids (e.g., cardiolipin) that might interact with NqrE in its native environment

Challenge 3: Loss of activity during storage

  • Solution: Store purified protein in glycerol (50%) at -20°C rather than -80°C to avoid freeze-thaw damage

  • Alternative: Lyophilize the protein in the presence of trehalose (6%) as a stabilizing agent

Challenge 4: Difficult reconstitution into functional complexes

  • Solution: Co-express multiple Na+-NQR subunits simultaneously rather than attempting to reconstitute from individually purified components

  • Verification method: Use FRET-based approaches with labeled subunits to confirm proper assembly

Troubleshooting decision tree:

  • Is the protein expressing? → Check by Western blot using antibodies against the fusion tag

  • Is the protein soluble? → Analyze detergent-solubilized fraction versus insoluble material

  • Is the protein properly folded? → Assess using limited proteolysis and CD spectroscopy

  • Is the protein functional? → Measure NADH oxidation activity in proteoliposomes

How can advanced biophysical techniques be applied to study NqrE structure and function?

Understanding the structure-function relationship of NqrE requires sophisticated biophysical approaches:

Structural analysis techniques:

  • Cryo-electron microscopy:

    • Most promising approach for resolving full Na+-NQR complex structure

    • Requires optimization of detergent micelle size and homogeneity

    • Can be combined with antibody fragments to improve particle orientation

  • Solid-state NMR spectroscopy:

    • Particularly valuable for examining NqrE in a lipid environment

    • Can provide information on dynamic processes during Na+ translocation

    • Requires isotopic labeling of specific residues of interest

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent-accessible regions and conformational changes

    • Can identify regions involved in subunit interactions

    • Provides insights into dynamic aspects of protein function

Functional characterization approaches:

  • Electrophysiological measurements:

    • Reconstitution into planar lipid bilayers for direct measurement of Na+ currents

    • Patch-clamp analysis of proteoliposomes

    • Ion flux measurements using radioactive tracers (22Na+)

  • Fluorescence-based techniques:

    • Site-specific labeling with environment-sensitive fluorophores

    • FRET measurements to detect conformational changes

    • Stopped-flow kinetic analysis of Na+ transport

  • Computational approaches:

    • Molecular dynamics simulations of NqrE in membrane environment

    • Prediction of Na+ binding sites and translocation pathways

    • In silico screening of potential inhibitors

These advanced approaches, when combined with traditional biochemical methods, provide a comprehensive understanding of how NqrE contributes to Na+ translocation and energy conservation in Cellvibrio japonicus .

How might NqrE research contribute to understanding the broader energy metabolism of polysaccharide-degrading bacteria?

Research on NqrE opens avenues for understanding how specialized bacteria like Cellvibrio japonicus coordinate energy metabolism with their remarkable capacity for polysaccharide degradation:

Integrative research opportunities:

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) to map connections between Na+-NQR activity and polysaccharide utilization

    • Flux balance analysis to quantify energy allocation during growth on different carbohydrate sources

    • Network modeling to predict metabolic adaptations under varying energy demands

  • Evolutionary perspectives:

    • Comparative genomics across polysaccharide-degrading bacteria to trace co-evolution of respiratory complexes with CAZyme repertoires

    • Analysis of horizontal gene transfer events that might have shaped Na+-NQR composition

    • Identification of regulatory networks that coordinate energy generation with substrate utilization

  • Ecological implications:

    • Investigation of how Na+-NQR efficiency influences competitive fitness in microbial communities

    • Examination of adaptation mechanisms to varying sodium concentrations in different ecological niches

    • Assessment of the role of energy metabolism in determining niche specialization

These research directions will provide valuable insights into how bacteria like Cellvibrio japonicus have evolved sophisticated energy transduction mechanisms to support their specialized metabolic capabilities, potentially informing bioenergy applications and our understanding of microbial community dynamics .

What biotechnological applications might emerge from understanding NqrE function in Cellvibrio japonicus?

The study of NqrE and the Na+-NQR complex in Cellvibrio japonicus has significant biotechnological implications:

Potential biotechnological applications:

  • Bioenergy production:

    • Engineering more efficient energy conservation systems in bacterial chassis used for cellulosic biofuel production

    • Optimizing Na+ cycling for enhanced growth and product formation in industrial fermentation

    • Developing bacterial strains with improved energy efficiency for consolidated bioprocessing of lignocellulosic materials

  • Enzyme stabilization and activity enhancement:

    • Understanding how energy metabolism supports the secretion and activity of the extensive CAZyme repertoire in C. japonicus

    • Engineering energy transduction systems to improve the production of valuable enzymes

    • Developing bacterial strains with optimized Na+ gradients for enhanced extracellular enzyme production

  • Bioelectrochemical systems:

    • Utilizing the Na+-NQR complex as a biological interface in microbial fuel cells

    • Engineering bacteria with modified Na+-NQR complexes for improved electron transfer to electrodes

    • Developing biosensors based on Na+-dependent energy transduction mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.