Recombinant Cerastes cerastes Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Production and Characterization

Recombinant Cerastes cerastes Cytochrome b is synthesized using a baculovirus expression system, ensuring high purity (>85% via SDS-PAGE) and stability . Key production details include:

ParameterDetail
Product CodeCSB-BP015075CGI1
SourceBaculovirus
Storage Conditions-20°C/-80°C (liquid: 6 months; lyophilized: 12 months)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for stability
Immunogen SpeciesCerastes cerastes

The protein corresponds to a partial sequence (amino acids 1–214) of the full-length cytochrome b .

Functional Studies

  • Complex III Deficiency Models: Mutations in MT-CYB (e.g., M4T in humans) impair complex III assembly and are linked to diseases like dilated cardiomyopathy . Recombinant cytochrome b enables mechanistic studies of these mutations .

  • Drug Interaction Assays: Yeast models expressing human MT-CYB variants reveal altered responses to antimalarial and antidepressant drugs, highlighting its utility in pharmacological research .

Clinical Relevance

  • Mitochondrial Disorders: Mutations in MT-CYB correlate with exercise intolerance, myopathy, and multi-organ dysfunction due to disrupted oxidative phosphorylation .

  • COVID-19 Associations: Specific CYB polymorphisms (e.g., A15326G, T15454C) are more prevalent in COVID-19 patients, suggesting mitochondrial involvement in viral pathogenesis .

Mutation Analysis in Disease Context

The table below summarizes MT-CYB mutations studied in clinical and experimental settings:

MutationEffectModel SystemKey Finding
m.14757T>C (M4T)Hydrophobic→polar substitutionHuman tissueLinked to dilated cardiomyopathy
p.Phe18LeuAlters Q<sub>i</sub> siteYeastEnhances clomipramine sensitivity
p.Asp171AsnDisrupts Q<sub>o</sub> siteYeastIncreases atovaquone sensitivity

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Cerastes cerastes (Horned desert viper)
Target Names
Target Protein Sequence
LINYKNMLHQHPLKLFNLLPVGSNISTWWNFGSMLLACLMIQTVTGFFLAIHYTANINLA FSSIIHITRDVPYGWIMQNTHAIGASMFFMCIYTHIARGLYYGSYLNKEVWLSGTTLLIV LMRTAFFGYVLPWGQMSFWAATVITNLLTAIPYLGNTLTTWLWGGFSINDPTLTRFFALH FILPFIIISLSSIHIILLHNEGSSNPLGTNSDID
Uniprot No.

Target Background

Function
Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that forms part of the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This proton gradient is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cerastes cerastes Cytochrome b (MT-CYB) and what is its significance in molecular research?

Cerastes cerastes Cytochrome b (MT-CYB) is a mitochondrial protein encoded by the MTCYB gene found in the Desert Horned Viper (Cerastes cerastes). As a component of respiratory complex III (cytochrome bc1 complex), it plays a crucial role in the electron transport chain and oxidative phosphorylation. The protein is particularly significant because it contains highly conserved regions across species while maintaining species-specific variations that make it valuable for phylogenetic studies.

Research significance of MT-CYB stems from several factors: its role in energy metabolism, its use as a molecular marker for evolutionary studies, and the potential functional insights gained from comparing viper mitochondrial proteins with human homologs. Mutations in human MTCYB have been associated with conditions like mitochondrial myopathy, encephalomyopathy, and MELAS syndrome, making comparative studies with non-human cytochrome b potentially valuable .

What expression systems are most effective for producing recombinant Cerastes cerastes MT-CYB?

The optimal expression system depends on your experimental goals. For functional studies requiring proper folding and post-translational modifications, mammalian expression systems (HEK293 or CHO cells) provide advantages despite lower yields. For structural studies requiring larger quantities, bacterial systems (E. coli) may be preferred with optimization.

Expression SystemAdvantagesLimitationsBest Applications
E. coli (BL21)High yield, cost-effective, rapid expressionMay form inclusion bodies, lacks post-translational modificationsStructural studies, antibody production
Insect cells (Sf9, Sf21)Better folding than bacteria, some post-translational modificationsModerate cost, more complex than bacterial systemsFunctional assays, protein-protein interaction studies
Mammalian cells (HEK293)Native-like folding and modificationsLower yield, highest costFunctional studies, complex interaction analyses
Cell-free systemsRapid, avoids toxicity issuesLimited scale, expensiveInitial screening, toxic protein expression

For recombinant MT-CYB expression, researchers often need to optimize codon usage based on the host system and consider fusion tags that enhance solubility without interfering with function. The cytotoxic properties observed in Cerastes cerastes venom studies suggest careful consideration of expression toxicity when designing experiments .

How can researchers verify the structural integrity of recombinant Cerastes cerastes MT-CYB?

Verification of structural integrity requires a multi-analytical approach:

  • Spectroscopic Analysis: Cytochrome b has characteristic absorption spectra in both reduced and oxidized states. UV-visible spectroscopy can confirm proper heme incorporation and folding.

  • Circular Dichroism (CD): Essential for confirming secondary structure elements match predictions based on homology models or known structures.

  • Thermal Shift Assays: These measure protein stability and can be compared with native protein or homologous proteins from related species.

  • Limited Proteolysis: Properly folded proteins typically show resistance to proteolytic digestion compared to misfolded variants.

  • Functional Assays: Electron transfer activity measurements using artificial electron acceptors/donors provide the most relevant validation.

Compare your recombinant protein data with known parameters from related species' cytochrome b proteins. Significant deviations may indicate structural issues requiring further optimization of expression or purification protocols.

How might recombinant Cerastes cerastes MT-CYB contribute to understanding mitochondrial disease mechanisms?

Recombinant Cerastes cerastes MT-CYB offers unique opportunities to investigate mitochondrial disease mechanisms through comparative studies with human MT-CYB. The protein can serve as a platform for modeling disease-associated mutations and examining their effects on protein function and stability.

Studies have identified mutations in human MTCYB associated with conditions like MELAS syndrome, as demonstrated in the case of a 15-year-old patient with a novel m.14864 T>C mutation causing a cysteine to arginine substitution at position 40 . By introducing equivalent mutations into recombinant Cerastes cerastes MT-CYB, researchers can:

  • Compare the structural and functional consequences across species

  • Identify conserved mechanisms of pathogenicity

  • Test potential therapeutic approaches in a controlled system

  • Investigate species-specific compensatory mechanisms that might inform therapeutic development

This approach is particularly valuable for studying positions that are highly conserved across species, as mutations at these sites typically have the most severe functional consequences. Creating a library of mutant constructs based on known human pathogenic variants provides a systematic approach to understanding mitochondrial disease mechanisms.

What potential applications exist for recombinant Cerastes cerastes MT-CYB in cancer research?

The application of recombinant Cerastes cerastes MT-CYB in cancer research extends from observations that components of Cerastes cerastes venom demonstrate significant anticancer activity. While the venom's cytotoxic effects have been directly studied, the specific role of MT-CYB could provide insights into novel anticancer mechanisms.

Studies of crude Cerastes cerastes venom (CV) and γ-irradiated venom (IRRV) have demonstrated significant cytotoxicity against multiple cancer cell lines. Against A549 lung cancer cells, IRRV showed an IC50 of 11 ± 0.66 μg/ml compared to 20 ± 1.80 μg/ml for CV. Similarly, against PC3 prostate cancer cells, IRRV demonstrated an IC50 of 18 ± 1.26 μg/ml versus 40 ± 3.20 μg/ml for CV .

Recombinant MT-CYB could be used to:

  • Investigate mitochondrial-specific anticancer mechanisms

  • Develop targeted approaches that exploit cancer cell metabolic vulnerabilities

  • Study if cytochrome b derivatives could synergize with established cancer treatments

  • Create novel cancer diagnostic tools based on differential interactions with cancer cell mitochondria

Research has demonstrated that Cerastes cerastes venom induces apoptosis in MCF-7 breast cancer cells, with an IC50 of 1.5 μg/ml, triggering pathways involving Bax upregulation and activation of caspase pathways . Investigating whether recombinant MT-CYB contributes to or could independently induce similar effects represents a promising research direction.

How can researchers optimize experimental design when studying recombinant Cerastes cerastes MT-CYB interactions with other mitochondrial proteins?

Optimizing experimental design for studying MT-CYB protein interactions requires careful consideration of several factors:

  • Membrane Protein Context: MT-CYB functions within the mitochondrial membrane as part of complex III. Consider using nanodiscs or liposomes to provide a membrane-like environment rather than studying the isolated protein in solution.

  • Oxidation State Control: MT-CYB exists in different oxidation states during its functional cycle. Ensure redox conditions are carefully controlled and monitored throughout experiments.

  • Interaction Detection Methods:

    • Co-immunoprecipitation with antibodies against interaction partners

    • Proximity labeling approaches (BioID, APEX)

    • Fluorescence resonance energy transfer (FRET) for dynamic interactions

    • Surface plasmon resonance for binding kinetics

  • Controls for Specificity:

    • Include MT-CYB from related species to determine specificity of interactions

    • Use site-directed mutagenesis to identify critical interaction residues

    • Compare with human MT-CYB to identify conserved interaction mechanisms

When designing experiments, consider that snake venom proteins like those from Cerastes cerastes have evolved unique properties that may influence protein-protein interactions. The venom's demonstrated effects on mitochondrial membrane potential and cytochrome c release in cancer cells suggest that MT-CYB might have species-specific interaction patterns worth investigating .

What purification strategies yield the highest purity and activity for recombinant Cerastes cerastes MT-CYB?

Purification of recombinant MT-CYB presents challenges due to its hydrophobic nature and heme cofactor requirement. A multi-step purification strategy is typically necessary:

  • Initial Extraction: For membrane proteins like MT-CYB, detergent solubilization is critical. Consider a panel of detergents:

DetergentConcentration RangeNotes
n-Dodecyl β-D-maltoside (DDM)0.5-1%Gentle, preserves activity
Digitonin0.5-2%Good for complex integrity
Triton X-1000.5-1%Effective but may affect activity
CHAPS0.5-1%Milder than Triton X-100
  • Affinity Chromatography: His-tag purification is common, but consider:

    • Position the tag at the terminus least likely to interfere with folding

    • Include longer linkers to improve accessibility

    • Consider dual tags (His + additional tag) for improved purity

  • Secondary Purification:

    • Size exclusion chromatography separates monomeric protein from aggregates

    • Ion exchange chromatography removes contaminating proteins with different charge properties

  • Quality Control:

    • SDS-PAGE and Western blotting for purity and identity

    • Spectroscopic analysis to confirm heme incorporation

    • Thermal stability assays to confirm proper folding

For highest activity retention, minimize time between purification steps and maintain cold temperatures throughout. Addition of glycerol (10-20%) and reducing agents can help maintain stability during purification. Based on protocols used for similar proteins, expected yield from optimized systems ranges from 1-5 mg/L in bacterial systems to 0.1-1 mg/L in mammalian expression systems.

What analytical techniques are most informative for characterizing the functional properties of recombinant Cerastes cerastes MT-CYB?

Comprehensive characterization of recombinant MT-CYB requires multiple analytical approaches:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy: Characteristic peaks at ~560-565 nm (reduced) and ~565-570 nm (oxidized) confirm heme incorporation

    • Resonance Raman spectroscopy: Provides details about heme environment and coordination state

  • Electron Transfer Activity:

    • Oxygen consumption measurements using oxygen electrodes

    • Cytochrome c reduction assays in reconstituted systems

    • Artificial electron acceptor/donor assays (e.g., using decylubiquinone)

  • Structural Characterization:

    • Circular dichroism for secondary structure analysis

    • Limited proteolysis for domain identification

    • Differential scanning calorimetry for thermal stability

  • Interaction Analysis:

    • Surface plasmon resonance for binding kinetics with partner proteins

    • Isothermal titration calorimetry for thermodynamic parameters

    • Blue native PAGE for complex formation analysis

Particularly important is comparing the functional properties of the recombinant protein with native protein or well-characterized homologs. This approach helps validate that the recombinant protein maintains properties similar to the native state, especially important given the complex membrane environment of MT-CYB in vivo.

What are the critical considerations when designing site-directed mutagenesis experiments with recombinant Cerastes cerastes MT-CYB?

Site-directed mutagenesis of MT-CYB requires careful planning:

  • Target Selection Criteria:

    • Conserved residues identified through multiple sequence alignment

    • Known disease-associated mutation sites in human MT-CYB

    • Predicted heme-interacting residues

    • Residues at interfaces with other complex III components

  • Mutation Strategy:

    • Conservative substitutions to study subtle functional effects

    • Non-conservative substitutions to probe essential roles

    • Cysteine scanning mutagenesis to identify accessible regions

    • Alanine scanning to identify functionally important residues

  • Experimental Controls:

    • Include wild-type protein in all experiments

    • Create multiple mutations at the same site (e.g., A→V, A→G) to distinguish steric from electronic effects

    • Consider creating equivalent mutations in MT-CYB from other species for evolutionary comparisons

  • Functional Impact Assessment:

    • Spectroscopic properties (changes in heme environment)

    • Electron transfer kinetics

    • Protein stability measurements

    • Complex assembly efficiency

One particularly relevant approach would be to create mutations equivalent to the human m.14864 T>C mutation (changing a conserved cysteine to arginine) reported in a MELAS patient . This would allow direct comparison of the functional effects of equivalent mutations across species, potentially yielding insights into species-specific compensation mechanisms.

How can researchers address issues of protein misfolding when expressing recombinant Cerastes cerastes MT-CYB?

Membrane proteins like MT-CYB are prone to misfolding during recombinant expression. Several strategies can mitigate this issue:

  • Expression Conditions Optimization:

    • Reduce expression temperature (16-25°C instead of 37°C)

    • Lower inducer concentration for gentler expression

    • Use specialized E. coli strains (e.g., C41/C43) designed for membrane proteins

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ)

  • Fusion Tag Selection:

    • Solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Consider the location of tags relative to transmembrane domains

  • Cofactor Supplementation:

    • Add δ-aminolevulinic acid to cultures to enhance heme biosynthesis

    • Consider adding hemin to the culture medium

  • Refolding Strategies:

    • Gradual dialysis from denaturing to native conditions

    • On-column refolding during purification

    • Detergent exchange methods

  • Quality Assessment:

    • Monitor folding using tryptophan fluorescence

    • Use limited proteolysis to distinguish folded from misfolded states

    • Employ thermal shift assays to quantify stability improvements

When optimizing conditions, it's essential to use functional assays rather than just yield as the primary metric. A small amount of correctly folded protein is more valuable than large amounts of misfolded material. Based on experience with similar proteins, co-expression with heme lyase or other proteins involved in heme incorporation may significantly improve folding efficiency.

What approaches can resolve data inconsistencies when comparing recombinant versus native Cerastes cerastes MT-CYB?

Inconsistencies between recombinant and native protein data are common challenges in research. To address these discrepancies:

  • Source Verification:

    • Confirm sequence identity between recombinant construct and reference sequence

    • Verify species identification for native protein source

    • Consider potential subspecies differences (e.g., Cerastes cerastes cerastes vs. Cerastes cerastes hoofieni)

  • Post-translational Modification Analysis:

    • Use mass spectrometry to identify modifications present in native but not recombinant protein

    • Consider expression systems that better recapitulate native modifications

  • Structural Analysis:

    • Compare spectroscopic properties between native and recombinant proteins

    • Analyze thermal stability profiles

    • Consider native PAGE analysis for oligomerization differences

  • Functional Comparison:

    • Develop quantitative assays for electron transfer activity

    • Compare substrate binding properties

    • Assess interaction with partner proteins from Complex III

  • Environmental Factors:

    • Test different buffer conditions to mimic native environment

    • Consider lipid composition effects on membrane protein function

    • Evaluate pH and ionic strength dependencies

When interpreting differences, it's important to consider that native MT-CYB functions within the intact Complex III in a lipid bilayer environment. Recombinant expression may not fully recapitulate this context, leading to functional differences that reflect environmental rather than intrinsic protein properties. Reconstitution experiments with defined lipid compositions can help distinguish these effects.

How can researchers overcome solubility challenges with recombinant Cerastes cerastes MT-CYB?

Solubility challenges are common with membrane proteins like MT-CYB. Systematic approaches to improving solubility include:

  • Detergent Screening:

    • Test a panel of detergents at various concentrations

    • Consider mixed detergent systems

    • Evaluate newer amphipathic polymers like amphipols

Detergent ClassExamplesOptimal Concentration RangeNotes
NonionicDDM, OG, Triton X-1001-2× CMCGenerally milder
ZwitterionicCHAPS, Fos-Choline1-3× CMCIntermediate harshness
IonicSDS, Sarkosyl0.5-1× CMCHarsh, may denature
Novel amphipathicSMA, amphipols, nanodiscsSystem-dependentBetter mimics native environment
  • Construct Optimization:

    • Truncate non-essential regions

    • Identify and remove aggregation-prone sequences

    • Consider chimeric constructs with soluble homologs

  • Solubilization Additives:

    • Glycerol (10-20%)

    • Arginine (50-200 mM)

    • Non-detergent sulfobetaines (NDSB)

    • Specific lipids (cardiolipin often stabilizes mitochondrial proteins)

  • Alternative Solubilization Approaches:

    • Bicelle systems

    • Nanodiscs for membrane protein stabilization

    • Cell-free expression directly into liposomes

  • Biophysical Monitoring:

    • Dynamic light scattering to assess aggregation state

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation for detailed solution behavior

When working with MT-CYB, begin with conditions established for cytochrome bc1 complex purification, then optimize specifically for the recombinant protein. The goal should be to identify conditions that maintain the protein in a monodisperse state suitable for functional and structural studies.

How might CRISPR-based approaches enhance the study of Cerastes cerastes MT-CYB function in cellular models?

CRISPR technology offers unprecedented opportunities for studying MT-CYB function through several innovative approaches:

  • Knock-in Models:

    • Generate cell lines expressing Cerastes cerastes MT-CYB in place of endogenous cytochrome b

    • Create chimeric proteins with domains from snake and mammalian cytochrome b

    • Introduce fluorescent tags for live-cell imaging of MT-CYB dynamics

  • Disease Modeling:

    • Introduce specific mutations equivalent to human disease mutations

    • Create isogenic cell lines differing only in MT-CYB sequence

    • Develop high-throughput CRISPR screens to identify genetic modifiers of MT-CYB function

  • Functional Screening:

    • Use CRISPR activation/interference to modulate expression of MT-CYB interacting partners

    • Perform genome-wide screens for synthetic lethality with MT-CYB variants

    • Identify species-specific differences in MT-CYB regulation

  • Technical Innovations:

    • Base editing for precise nucleotide changes without double-strand breaks

    • Prime editing for targeted insertions and deletions

    • CRISPRa/CRISPRi for modulating expression without sequence changes

The ability to precisely edit mitochondrial DNA using newer CRISPR techniques could revolutionize the field by allowing direct manipulation of MT-CYB in its native genomic context. This would overcome many limitations of recombinant expression systems and provide more physiologically relevant insights into function.

What role might recombinant Cerastes cerastes MT-CYB play in developing new therapeutic approaches for mitochondrial disorders?

Recombinant Cerastes cerastes MT-CYB offers unique potential for therapeutic development:

  • Comparative Structure-Function Analysis:

    • Identify structural features that confer resistance to dysfunction

    • Map species-specific compensatory mechanisms

    • Develop peptide therapeutics based on key functional domains

  • Drug Screening Platforms:

    • Use recombinant MT-CYB to screen for compounds that stabilize mutant proteins

    • Develop assays using MT-CYB to identify molecules that enhance mitochondrial function

    • Create biosensors for high-throughput screening of electron transport modulators

  • Therapeutic Protein Development:

    • Engineer hybrid proteins incorporating stable elements from Cerastes cerastes MT-CYB

    • Develop mitochondrial targeting strategies for recombinant proteins

    • Explore gene therapy approaches using optimized MT-CYB sequences

  • Mitochondrial Disease Models:

    • Create cellular models expressing both human and Cerastes cerastes MT-CYB variants

    • Compare responses to stressors and potential therapeutic agents

    • Identify compensatory pathways that could be therapeutically targeted

The unique evolutionary adaptations in snake mitochondrial proteins may provide insights into natural solutions for mitochondrial dysfunction. The identification of a novel mutation in human MTCYB associated with MELAS syndrome highlights the clinical relevance of understanding cytochrome b structure-function relationships across species.

How could bioinformatic approaches advance our understanding of Cerastes cerastes MT-CYB evolution and function?

Bioinformatic analyses provide powerful tools for understanding MT-CYB:

  • Evolutionary Analysis:

    • Molecular clock analyses to date divergence events

    • Selection pressure analysis to identify functionally important residues

    • Ancestral sequence reconstruction to understand evolutionary trajectories

    • Comparative analysis of MT-CYB across Viperidae to identify adaptations

  • Structural Bioinformatics:

    • Homology modeling based on crystallized cytochrome bc1 complexes

    • Molecular dynamics simulations to explore conformational dynamics

    • In silico mutagenesis to predict effects of mutations

    • Protein-protein docking to model interactions within Complex III

  • Systems Biology Approaches:

    • Integration of transcriptomic and proteomic data to understand mitochondrial network effects

    • Flux balance analysis to predict metabolic consequences of MT-CYB variants

    • Construction of species-specific mitochondrial interactomes

    • Comparative pathway analysis across reptilian species

  • Machine Learning Applications:

    • Development of predictive models for MT-CYB mutation effects

    • Pattern recognition in sequence-function relationships

    • Automated structure prediction with newer AI methods

    • Integration of multi-omics data to identify novel functional insights

Bioinformatic approaches are particularly valuable given the taxonomic position of Cerastes cerastes within the Viperidae family , allowing for comparative studies across related species with varying ecological adaptations. Such analyses can reveal how evolutionary pressures have shaped MT-CYB function in different lineages and inform our understanding of fundamental mitochondrial biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.