Recombinant Ceratitis capitata Protein white (W)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Ceratitis capitata Protein white (W) corresponds to the full-length protein encoded by the wp gene (UniProt ID: Q17320). Key features include:

PropertyDetails
Amino Acid Length679 residues
DomainsMajor Facilitator Superfamily (MFS) domain (pfam07690)
Expression SystemEscherichia coli (E. coli)
TagN-terminal His tag
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for long-term storage

This protein is associated with catecholamine transport defects that lead to the white pupae phenotype, a recessive trait used to sex-sort insects in SIT programs .

Role in Pupal Coloration

The wp gene encodes a metabolite transport protein critical for transferring catecholamines (e.g., dopamine) to the pupal cuticle. Mutations in this gene disrupt melanization, resulting in white pupae . Structural studies reveal:

  • Conserved MFS Domain: Facilitates substrate transport across membranes .

  • CRISPR/Cas9 Validation: Knockout experiments in C. capitata and Bactrocera tryoni confirmed that frameshift mutations (e.g., 4–155 bp deletions) induce the wp phenotype .

Genetic Linkage

The wp locus is tightly linked to the temperature-sensitive lethal (tsl) gene on chromosome 5 (position 59B–61C), enabling dual-marker systems in genetic sexing strains (GSS) .

Sterile Insect Technique (SIT)

  • Sex-Sorting: wp mutants enable automated female removal during mass rearing .

  • Strain Development: CRISPR-edited wp strains (e.g., VIENNA 8) are deployed in SIT programs to suppress pest populations .

Biochemical Research

The recombinant protein is used to:

  • Study catecholamine transport mechanisms .

  • Screen for novel mutations affecting pupal pigmentation .

Genomic and Transcriptomic Analysis

  • Mutation Types: Natural wp mutations include frameshift deletions (e.g., 37 bp in Bactrocera dorsalis) and in-frame amino acid losses (e.g., 1–3 residues in C. capitata) .

  • Evolutionary Conservation: Orthologs of wp exist in B. dorsalis and Zeugodacus cucurbitae, suggesting a conserved role across Tephritidae .

CRISPR/Cas9 Validation

  • Medfly: Injecting Cas9/gRNA into embryos produced G2 progeny with 100% white pupae penetrance .

  • B. tryoni: Four distinct frameshift mutations induced wp phenotypes, confirming gene functionality .

Table 2: Key Mutational Studies

SpeciesMutation TypePhenotypic Outcome
C. capitata1–3 aa deletionsPartial loss of transport function
B. dorsalis37 bp frameshiftComplete loss of melanization
B. tryoni4–155 bp deletionsHomozygous white pupae

Future Directions

  • Mechanistic Studies: Elucidate substrate specificity of the MFS domain .

  • Broad-Spectrum Applications: Engineer wp-based GSS in non-tephritid pests (e.g., Anastrepha ludens) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
W; Protein white
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-679
Protein Length
full length protein
Species
Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)
Target Names
W
Target Protein Sequence
MGQEDQEVLIRGGKATSTSAESLNNNNEQPYEQSSINQGFCKNYGTLSPPSPALTADNLT YSWYNLDVFGAVHQPGSSWKQLVNRVKGVFCNERHIPAPRKHLLKNDSGVAYPGELLAVM GSSGAGKTTLLNASAFRSSKGVQISPSTIRMLNGHPVDAKEMQARCAYVQQDDLFIGSLT AREHLIFQAMVRMPRHMTQKQKVQRVDQVIQDLSLGKCQNTLIGVPGRVKGLSGGERKRL AFASEALTDPPLLICDEPTSGLDSFMAHSVVQVLKKLSQKGKTVILTIHQPSSELFELFD KILLMAEGRVAFLGTPGEAVDFFSYIGATCPTNYTPADFYVQVLAVVPGREVESRDRVAK ICDNFAVGKVSREMEQNFQKLVKSNGFGKEDENEYTYKASWFMQFRAVLWRSWLSVLKEP LLVKVRLLQTTMVAVLIGLIFLGQQLTQVGVMNINGAIFLFLTNMTFQNSFATITVFTTE LPVFMRETRSRLYRCDTYFLGKTIAELPLFLVVPFLFTAIAYPLIGLRPGVDHFFTALAL VTLVANVSTSFGYLISCACSSTSMALSVGPPVIIPFLLFGGFFLNSGSVPVYFKWLSYLS WFRYANEGLLINQWADVKPGEITCTLSNTTCPSSGEVILETLNFSASDLPFDFIGLALLI VGFRISAYIALTMRARRKE
Uniprot No.

Target Background

Function
This protein may be part of a membrane-spanning permease system crucial for transporting pigment precursors into pigment cells, which play a role in determining eye color.
Protein Families
ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the white gene in Ceratitis capitata and what is its primary function?

The white gene in Ceratitis capitata (Mediterranean fruit fly) encodes a protein essential for eye pigmentation and is orthologous to white genes found in Drosophila melanogaster and other Diptera. Functionally, the protein belongs to the ATP-binding cassette (ABC) transporter family and is involved in the transport of pigment precursors into developing cells during eye development. The protein consists of 679 amino acids and contains characteristic ATP-binding cassette domains required for its transport function .

The white (W) protein plays a crucial role in the import of pigment precursors like guanine and tryptophan into cells during eye development. When mutations occur in this gene, they result in the distinctive white-eyed phenotype. The role of this protein extends beyond simple pigmentation, as it has also been implicated in behavioral traits in other Diptera, suggesting broader physiological significance .

How was the white gene in Ceratitis capitata initially identified and characterized?

The white gene in C. capitata was initially identified through correlation with a spontaneous mutation causing white eyes in the medfly. Researchers isolated a complementary DNA clone derived from the medfly white gene that showed substantial similarity to white genes in Drosophila melanogaster and other Diptera .

The genomic organization of the white gene in C. capitata has been characterized at the molecular level, revealing an approximately 14-kb region of genomic DNA encoding the wild-type white eye (w+) color gene. Comparison of the intron-exon organization of this locus among several dipteran insects has revealed distinct organizational patterns that align with the phylogenetic relationships of these flies .

The gene has been mapped to chromosome 5 of the medfly, and its genomic location has been further refined through cytogenetic studies to position 59B of the trichogen polytene chromosome map, which corresponds to position 76B of the salivary gland polytene chromosome map .

What are the known mutations in the white gene of Ceratitis capitata and their phenotypic effects?

Several mutations in the white gene of C. capitata have been characterized:

MutationLocationMolecular ChangePhenotypic Effect
w1Exon 6Frameshift mutationWhite eyes, white pupae
w2Exon 2Large deletionWhite eyes, white pupae
wp-(nat)Various positionsNatural occurrenceWhite pupae
wp-(CRISPR)Targeted positionsCRISPR-inducedWhite pupae

Cloning and sequencing of two mutant white alleles, w1 and w2, from the we,wp and M245 strains, respectively, indicate that the mutant conditions in these strains are the result of independent events—a frameshift mutation in exon 6 for w1 and a deletion including a large part of exon 2 in the case of w2 .

Importantly, even the loss of a single amino acid without a frameshift at specific positions can cause the white pupae phenotype, demonstrating the functional sensitivity of this protein. Research has shown that the white pupae phenotype is monogenic and recessive in C. capitata, making it an ideal marker for genetic studies .

How does the genomic organization of the white gene in Ceratitis capitata compare to other Diptera?

Comparative analysis of the white gene's intron-exon organization among several dipteran insects reveals distinct organizational patterns that are consistent with their phylogenetic relationships. The comparison includes the predicted primary amino acid sequence of the white loci across species .

The white gene in medfly shows substantial similarity to white genes in Drosophila melanogaster and other Diptera, but with species-specific organizational features. These differences reflect evolutionary divergence while maintaining core functional domains essential for pigment transport .

How is the white gene utilized in the development of genetic sexing strains (GSS) for sterile insect technique programs?

The white gene, particularly its white pupae (wp) mutation, has been fundamental in developing genetic sexing strains (GSS) for sterile insect technique (SIT) programs. This approach works through the following methodology:

  • A Y-autosome translocation is created where the wild-type allele of the white gene is linked to the Y chromosome (male-determining)

  • The autosomal recessive white mutation is homozygous on both female autosomes

  • This results in males having brown pupae (due to the wild-type allele on the Y chromosome) and females having white pupae (due to homozygous recessive mutations)

  • The pupal color difference allows for automated mechanical sorting of males and females

This system has been successfully implemented in C. capitata (VIENNA strains), B. dorsalis, and Z. cucurbitae. The full penetrance expressivity and recessive inheritance rendered wp the marker of choice for GSS construction in these tephritid species .

What is the relationship between the white gene and the temperature-sensitive lethal (tsl) phenotype in GSS strains?

In the most successful GSS developed so far (the C. capitata VIENNA 8 GSS), two selectable markers are used in combination: the white pupae (wp) gene and the temperature-sensitive lethal (tsl) gene. Both genes are located on chromosome 5, with the tsl gene positioned between the wp and Zw loci .

The proximity of these genes on chromosome 5 is critical for the effectiveness of the GSS system. Cytogenetic studies have determined that:

  • The wp gene is localized at position 59B of the trichogen polytene chromosome map

  • The tsl gene is localized in the region 59B–61C, in close proximity to wp

  • The chromosomal inversion D53 spans the region 50B–59C of chromosome 5, acting as a recombination suppressor to enhance genetic stability

How can CRISPR/Cas9 gene editing be used to generate white pupae strains in tephritid species?

CRISPR/Cas9 gene editing provides a powerful approach for generating white pupae strains in tephritid species through the following methodological steps:

  • Design of guide RNAs (gRNAs) targeting specific regions of the white gene

  • Preparation of Cas9 protein and gRNA mixtures for embryo injection

  • Microinjection into wild-type embryos

  • Backcrossing of G0 adults to existing white pupae mutant strains for complementation assays

  • Selection and establishment of homozygous white pupae lines

In C. capitata, researchers targeted the third exon of the white gene containing the MFS domain of the presumed Cc_wp CDS. Using this approach, they injected 588 wild-type embryos, of which 67 pupated and 63 adults (G0) emerged. When these G0 flies were backcrossed to strains carrying the naturally occurring white pupae mutation, the G1 offspring showed white pupae phenotypes, confirming successful gene editing .

Similar approaches have been used to generate white pupae strains in B. tryoni, demonstrating the transferability of this technique across tephritid species. The efficiency of this method makes it a valuable tool for rapidly developing genetic sexing strains for new target species .

What are the comparative advantages of using recombinant white protein versus gene editing approaches in research applications?

Both recombinant protein and gene editing approaches offer distinct advantages for different research applications:

ApproachAdvantagesResearch Applications
Recombinant white protein- Allows protein-level studies
- Enables in vitro binding assays
- Facilitates antibody development
- Permits structure-function analysis
- Biochemical characterization
- Drug screening
- Protein interaction studies
- Structural biology
Gene editing (CRISPR/Cas9)- Creates stable mutant lines
- Enables in vivo phenotypic studies
- Allows creation of GSS strains
- Provides whole-organism effects
- Genetic sexing strain development
- Functional genomics
- SIT program enhancement
- Evolutionary studies

Recombinant white protein, such as the His-tagged version expressed in E. coli, provides a tool for biochemical and structural studies of the protein itself . This approach is valuable for understanding protein interactions, conducting in vitro assays, and developing antibodies for detection purposes.

Gene editing approaches offer the advantage of creating stable mutant lines that can be directly used in SIT programs. The CRISPR/Cas9 system has demonstrated high efficiency in generating white pupae phenotypes in multiple tephritid species, making it the preferred method for developing new genetic sexing strains .

What are the optimal expression systems and purification methods for recombinant Ceratitis capitata white protein?

Based on available research, the following methodological approaches are recommended for expression and purification of recombinant C. capitata white protein:

Expression Systems:

  • E. coli has been successfully used for expression of full-length His-tagged white protein (679 amino acids)

  • For functional studies, eukaryotic expression systems may be preferable as they allow post-translational modifications

Purification Protocol:

  • Express the protein with an N-terminal His-tag in E. coli

  • Harvest cells and lyse in appropriate buffer containing protease inhibitors

  • Purify using nickel affinity chromatography

  • Consider further purification steps such as ion exchange or size exclusion chromatography if higher purity is required

  • Lyophilize the purified protein for long-term storage

  • Reconstitute in appropriate buffer (Tris/PBS-based buffer, pH 8.0 with 6% Trehalose is recommended)

Storage Considerations:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstituted protein should be stored with 5-50% glycerol (50% recommended) and aliquoted for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

How can researchers design effective CRISPR/Cas9 targeting strategies for the white gene in different tephritid species?

When designing CRISPR/Cas9 targeting strategies for the white gene in tephritid species, researchers should follow these methodological guidelines:

  • Identify the white gene ortholog in the target species:

    • Use sequence similarity searches against available genomic resources

    • Focus on conserved functional domains like the ATP-binding cassette domains

  • Select optimal target sites:

    • Use design tools like CHOPCHOP to identify potential Cas9 target sequences

    • Target conserved functional domains (e.g., the MFS domain in exon 3)

    • Design multiple independent sgRNAs to increase chances of success

  • Minimize off-target effects:

    • Perform whole-genome searches to identify potential off-target sites

    • Select targets with minimal similarity to other genomic regions

    • Consider using high-fidelity Cas9 variants

  • Delivery method optimization:

    • For tephritid embryos, microinjection protocols should be optimized for each species

    • Cas9 protein with in vitro transcribed sgRNA typically works better than plasmid-based expression

    • Consider appropriate buffer composition and injection timing

  • Efficient screening strategies:

    • Design PCR primers flanking the target site for genotyping

    • Consider complementation tests with existing white mutants

    • Use phenotypic screening at pupal and adult stages

Research has shown that survival rates after injection with Cas9 protein can be lower (15-19%) compared to buffer-only injections (30%), indicating some toxicity. This should be considered when planning experiments and sample sizes .

What are the current limitations in working with recombinant Ceratitis capitata white protein and how might they be addressed?

Several challenges exist when working with recombinant C. capitata white protein:

ChallengeDescriptionPotential Solutions
Protein solubilityThe white protein contains multiple transmembrane domains, making it difficult to obtain in soluble form- Use detergents or lipid nanodiscs
- Express specific domains rather than full-length protein
- Optimize buffer conditions
Functional activityMaintaining transport activity in recombinant systems is challenging- Consider reconstitution in proteoliposomes
- Develop functional assays based on substrate binding rather than transport
- Use eukaryotic expression systems
Structural characterizationThe complex structure makes crystallography challenging- Use cryo-EM approaches
- Apply computational modeling based on homologous proteins
- Focus on individual domains
StabilityProtein degradation during purification and storage- Optimize purification conditions
- Add stabilizing agents (trehalose, glycerol)
- Store as lyophilized powder

To address these limitations, researchers can explore alternative expression systems like insect cells (Sf9, S2) that may better handle the post-translational modifications required for full functionality. Additionally, developing improved functional assays that don't require membrane reconstitution could expand the utility of the recombinant protein for screening and mechanistic studies.

How might white gene research in Ceratitis capitata inform the development of new genetic control strategies for other pest species?

The white gene research in C. capitata provides a valuable model for developing genetic control strategies in other pest species through several mechanisms:

  • Generic approach to GSS development:

    • The conserved nature of the white gene across insect species enables a template for identifying and targeting orthologous genes in other pests

    • The parallelism of white pupae mutations in different tephritid species suggests similar approaches would work in related species

  • Accelerated development timeline:

    • CRISPR/Cas9-mediated knockout of the white gene provides a rapid method for creating new genetic sexing strains

    • This approach has already been successfully applied to B. tryoni, demonstrating its transferability

  • Enhanced SIT applications:

    • White pupae sexing mechanisms can be combined with additional genetic elements like gene drives

    • Research has shown that homing-based gene drives can be integrated with sex conversion systems in C. capitata

  • Potential application to disease vectors:

    • Similar approaches could be applied to mosquito species for malaria or dengue control

    • The temperature-sensitive lethal mechanism, once molecularly identified, could be transferred to mosquito systems

The conserved phenotype and independent nature of white mutations across species suggest this technique can provide a generic approach to produce sexing strains in other major agricultural and medical insect pests. Future research should focus on identifying white gene orthologs in target pest species and optimizing CRISPR/Cas9 protocols for efficient mutation induction .

What potential exists for integrating white gene manipulations with gene drive systems for pest management?

Recent research has demonstrated significant potential for integrating white gene manipulations with gene drive systems:

  • Proof-of-concept experiments:

    • The white gene has been successfully used as a target for testing homing-based gene drives in C. capitata

    • Experiments have shown germlines are amenable to homologous recombination-based repair, a prerequisite for gene drive function

  • Regulatory elements for drive expression:

    • Researchers have evaluated several conserved regulatory elements for driving Cas9 expression:

      • nanos (74.7% efficiency in females, 5.5% in males)

      • vasa (35.4% efficiency in females, 36.2% in males)

      • zpg (49.5% efficiency in females, 34.8% in males)

  • Combined systems:

    • White gene disruption can serve as a visible marker for gene drive activity

    • Integration with sex conversion systems has been demonstrated using the transformer gene (Cctra) in C. capitata

    • This combination achieved 83.1% transmission rates, higher than observed within the white-eye locus alone

  • Future applications:

    • Potential for developing self-limiting population suppression systems

    • Possibilities for integrating multiple control mechanisms (e.g., white pupae sexing + gene drive + sterility)

    • Application to other agricultural pests and disease vectors

These integrated approaches represent the cutting edge of genetic pest management systems. The white gene serves not only as a useful marker but also as a testing ground for developing and optimizing gene drive components before deployment in more complex systems .

What methods are most effective for studying white gene expression patterns during Ceratitis capitata development?

Several complementary approaches have proven effective for studying white gene expression patterns during medfly development:

  • RNA-Seq analysis:

    • Enables quantitative assessment of transcript abundance across developmental stages

    • Can identify alternative splicing events and isoform expression

    • Provides genome-wide context for expression patterns

  • RT-PCR and qRT-PCR:

    • Allows stage-specific and tissue-specific expression analysis

    • More accessible technique requiring less sophisticated equipment

    • Useful for validating RNA-Seq findings with higher sample numbers

  • In situ hybridization:

    • Provides spatial information about gene expression within tissues

    • Has been successfully used to localize white gene expression in developing eye tissues

    • Allows correlation between expression patterns and phenotypic development

  • Reporter gene constructs:

    • Fusion of white gene regulatory elements with reporter genes (GFP, LacZ)

    • Enables visualization of expression patterns in live tissues

    • Useful for dissecting regulatory element function

Studies examining white gene expression during medfly development have shown patterns similar to those observed for white gene homologues in Drosophila melanogaster and other insects. This conservation of expression patterns reflects the fundamental role of this gene in eye pigmentation across Diptera .

How can researchers assess the functional consequences of specific mutations in the white gene?

To assess the functional consequences of specific mutations in the white gene, researchers can employ several methodological approaches:

  • Phenotypic characterization:

    • Detailed analysis of eye color phenotypes at different developmental stages

    • Quantitative measurement of pigment levels in mutant versus wild-type flies

    • Assessment of puparium color and sclerotization

  • Complementation tests:

    • Cross newly generated mutants with existing white mutant strains

    • Analyze F1 progeny for complementation of the mutant phenotype

    • This approach has been successfully used to confirm CRISPR-induced mutations affect the same gene as natural mutations

  • Molecular characterization of mutations:

    • Sequence analysis to identify the precise molecular nature of mutations

    • Correlation between mutation type (frameshift, deletion, etc.) and phenotypic severity

    • Examples include the w1 frameshift mutation in exon 6 and the w2 deletion in exon 2

  • Biochemical analysis:

    • Study of pigment precursor transport in wild-type versus mutant cells

    • Comparison of ATP binding and hydrolysis in recombinant wild-type and mutant proteins

    • Analysis of protein stability and cellular localization

  • Transgenic rescue experiments:

    • Introduction of wild-type white gene into mutant background

    • Assessment of phenotypic rescue to confirm causality

    • Cross-species rescue (e.g., medfly white gene rescuing Drosophila white mutants)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.