Recombinant Ceratophyllum demersum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Ceratophyllum demersum ATP synthase subunit a, chloroplastic (atpI), is a bioengineered protein derived from the aquatic plant Ceratophyllum demersum. This subunit belongs to the ATP synthase complex, which catalyzes ATP synthesis in chloroplasts through proton translocation. The recombinant form is expressed in E. coli with an N-terminal His-tag for purification and structural studies .

Protein Architecture

ParameterDescription
Gene IDatpI (Accession: A8SE70)
Length247 amino acids (1–247 aa)
HostE. coli
TagN-terminal His-tag
Purity≥85% (SDS-PAGE verified)

The atpI subunit is a transmembrane component of the F₀ sector of chloroplast ATP synthase, forming part of the proton channel. It interacts with the c-ring (composed of c-subunits) to facilitate proton translocation across the thylakoid membrane, driving ATP synthesis .

Key Roles in ATP Synthase Function

  1. Proton Translocation: The a subunit coordinates with the c-ring to create a rotational mechanism for H⁺ movement, enabling energy coupling between the thylakoid lumen and stroma .

  2. Structural Studies: The His-tagged recombinant protein facilitates crystallization and cryo-EM analysis to resolve the subunit’s conformational dynamics .

  3. Cross-Species Functional Analysis: Comparative studies with atpI homologs (e.g., Rhodospirillum rubrum, Chlamydomonas reinhardtii) highlight species-specific adaptations in proton channel efficiency .

Comparative Analysis with Homologs

OrganismGene NameHostApplication
Ceratophyllum demersumatpIE. coliChloroplast ATP synthase studies
Hordeum vulgareatpIE. coliCereal plant ATP synthase modeling
Zea maysatpIE. coliMaize chloroplast bioenergetics research

Regulation and Assembly

  • Cofactor Dependency: The a subunit’s activity is modulated by the c-ring stoichiometry and proton gradient magnitude .

  • Dimerization: In mitochondrial ATP synthase, dimerization of the F₀F₁ complex is critical for cristae formation, but chloroplast homologs like C. demersum atpI may exhibit distinct oligomerization patterns .

Unresolved Questions

  1. Species-Specific Adaptations: How does C. demersum’s atpI optimize proton translocation in low-light environments?

  2. Thermostability: Does the His-tag affect the protein’s stability in high-temperature assays?

  3. Heterologous Expression: Can C. demersum atpI reconstitute functional ATP synthase in heterologous systems (e.g., bacterial membranes)?

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This information can be used as a reference for your specific needs.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Ceratophyllum demersum (Rigid hornwort) (Coontail)
Target Names
atpI
Target Protein Sequence
MNVLPCSMNTLKGLYEISGVEVGQHFYWQIGGFQIHAQVLITSWVVIAILLGSAAIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEDYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSAAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant C. demersum atpI protein?

E. coli is the predominantly used expression system for recombinant C. demersum atpI protein production due to several methodological advantages:

  • High yield: E. coli can produce substantial quantities of recombinant protein

  • Ease of genetic manipulation: Well-established protocols for vector construction and transformation

  • Cost-effectiveness: Inexpensive culture media and rapid growth

The typical workflow involves:

  • Cloning the full-length atpI gene (1-247aa) into an expression vector with an N-terminal His-tag

  • Transformation into an appropriate E. coli strain (commonly BL21(DE3))

  • Induction of protein expression with IPTG

  • Cell lysis and protein purification using affinity chromatography

  • Quality control by SDS-PAGE (≥90% purity)

Though bacterial expression is common, membrane proteins can present challenges with proper folding. Alternative systems including yeast or baculovirus-infected insect cells may be considered for structural studies requiring native conformation .

What purification strategies yield the highest purity and activity for recombinant atpI?

Purification of recombinant C. demersum atpI requires specialized approaches due to its hydrophobic nature as a membrane protein:

Recommended purification protocol:

  • Membrane isolation: Differential centrifugation to separate membrane fractions

  • Solubilization: Use of mild detergents (DDM, LMNG, or C12E8) to extract the protein

  • IMAC purification: Immobilized metal affinity chromatography using the His-tag

  • Size exclusion chromatography: To remove aggregates and obtain homogeneous protein

  • Buffer optimization: Typically Tris/PBS-based buffer with 6% trehalose at pH 8.0

For highest activity retention, it is recommended to:

  • Maintain cold temperatures (4°C) throughout purification

  • Add glycerol (final concentration 50%) for storage

  • Avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

Purity assessment by SDS-PAGE should show ≥90% purity for most research applications .

How does recombinant atpI interact with other ATP synthase subunits in reconstitution experiments?

Reconstitution of functional ATP synthase complexes using recombinant subunits provides critical insights into assembly mechanisms and subunit interactions. For atpI:

Key interaction partners:

  • atpH (subunit c): Forms the proton-conducting interface with atpI

  • atpF (subunit b): Connects the membrane-embedded F0 with the catalytic F1 portion

Reconstitution studies show that atpI interacts directly with the c-ring (atpH), forming an asymmetric proton channel. The highly conserved arginine residue in atpI interacts with the deprotonated glutamate/aspartate in subunit c, facilitating proton movement.

Methodological approaches for studying interactions:

  • Co-immunoprecipitation: Pull-down assays using tagged recombinant proteins

  • Yeast two-hybrid: For detecting binary protein interactions

  • Cryo-EM: For structural visualization of reconstituted complexes

  • Cross-linking studies: To identify interaction interfaces

Recent studies have demonstrated that peripheral stalk subunits (atpF) are essential for ATP synthase biogenesis and function. Knock-out experiments with atpF resulted in complete prevention of ATP synthase accumulation, highlighting the importance of correct subunit interactions .

What site-directed mutagenesis approaches have provided insights into atpI function?

Site-directed mutagenesis of recombinant atpI offers powerful insights into structure-function relationships:

Critical residues for mutagenesis studies:

  • Conserved charged residues in transmembrane regions

  • Residues at the atpI-atpH interface

  • Amino acids involved in proton translocation

Methodological workflow:

  • Identify conserved or functionally important residues through sequence analysis

  • Generate point mutations using PCR-based techniques

  • Express and purify mutant proteins using standardized protocols

  • Assess functional impact through:

    • ATP synthesis assays

    • Proton translocation measurements

    • Structural studies

Research has shown that mutating key residues in the transmembrane domain disrupts proton translocation and ATP synthesis. For example, altering the conserved arginine residue in atpI completely abolishes ATP synthase function by disrupting the critical interaction with the c-ring .

Table 1: Functional consequences of key atpI mutations

MutationLocationFunctional EffectStructural Impact
R210ATM domainLoss of ATP synthesisDisrupted H+ path
E219QTM domainReduced ATP synthesisAltered proton affinity
N214ATM domainMinimal effectNon-essential for function
W141ATM interfaceDestabilized complexReduced assembly

How do phospholipid environments affect the stability and activity of recombinant atpI?

The lipid environment significantly influences atpI stability and function, as it is a membrane-embedded protein:

Optimal lipid composition:

  • Phosphatidylglycerol (PG) and phosphatidylethanolamine (PE) provide stability

  • Monogalactosyldiacylglycerol (MGDG) and digalactosyldiacylglycerol (DGDG), characteristic of thylakoid membranes, enhance function

  • Cholesterol disrupts activity in reconstituted systems

Methodological approaches:

  • Liposome reconstitution: Embedding purified atpI in artificial membrane systems

  • Nanodiscs: Creating defined membrane patches with controlled lipid composition

  • Proteoliposomes: For functional assays of proton translocation

Research indicates that thylakoid-like lipid compositions (high in galactolipids) improve stability and functional activity of reconstituted atpI compared to standard phospholipid mixtures used in many recombinant protein studies .

When studying recombinant atpI, researchers should consider incorporating thylakoid-mimicking lipid environments to obtain physiologically relevant results, particularly for functional studies.

What approaches can resolve contradictory data regarding atpI post-translational modifications?

Contradictory reports regarding post-translational modifications (PTMs) of atpI can be addressed through careful methodological approaches:

Resolution strategies:

  • Comprehensive PTM profiling:

    • Mass spectrometry with multiple fragmentation methods (CID, ETD, HCD)

    • Enrichment strategies for specific modifications (phosphorylation, O-GlcNAcylation)

    • Use of modification-specific antibodies

  • Verification in different systems:

    • Compare native and recombinant proteins

    • Examine modifications across multiple species

    • Assess developmental and environmental variation

  • Functional assessment:

    • Generate site-specific mutants that mimic or prevent modification

    • Develop reconstitution systems with modified and unmodified proteins

    • Compare ATP synthesis rates and proton translocation efficiency

Recent research has indicated that O-GlcNAcylation can affect ATP synthase activity, as demonstrated in ATP synthase subunit α (ATP5A), where decreased O-GlcNAcylation resulted in reduced ATP production and ATPase activity . This suggests that similar modifications might occur in other subunits, including atpI, with functional consequences.

How can recombinant atpI be utilized in structural studies of ATP synthase assembly?

Recombinant atpI serves as a valuable tool for structural investigations of ATP synthase assembly:

Methodological approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Recent technological advances enable high-resolution structures of membrane protein complexes

    • Reconstitution of atpI with other subunits in nanodiscs provides insights into assembly intermediates

    • Single-particle analysis can capture different conformational states

  • X-ray crystallography:

    • Crystallization of atpI alone or with interacting partners

    • Use of antibody fragments or nanobodies to stabilize specific conformations

    • Lipidic cubic phase crystallization for membrane proteins

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies interaction interfaces between atpI and other subunits

    • Maps the spatial arrangement of subunits within the complex

    • Can capture transient interactions during assembly

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probes conformational dynamics and solvent accessibility

    • Identifies regions involved in subunit interactions

    • Detects conformational changes upon assembly

Recent cryo-EM studies have provided atomic models for different conformational states of spinach chloroplast ATP synthase, including insights into how membrane-embedded subunits like atpI are arranged within the complex . These structural approaches are essential for understanding how atpI contributes to ATP synthase assembly and function.

What is the role of atpI in the biogenesis and assembly of chloroplast ATP synthase?

The assembly of chloroplast ATP synthase is a highly coordinated process involving nuclear and chloroplast-encoded subunits:

atpI's role in biogenesis:

  • Forms part of the initial membrane-embedded F0 subcomplex

  • Serves as an anchor point for subsequent assembly steps

  • Coordinates insertion of the c-ring (atpH) into the membrane

Assembly pathway involving atpI:

  • Integration of atpI into the thylakoid membrane

  • Association with atpH subunits to form the proton channel

  • Recruitment of peripheral stalk subunits (atpF)

  • Attachment of the preassembled F1 catalytic core

Research has shown that the absence of membrane subunits prevents the accumulation of a functional ATP synthase complex. Studies in Chlamydomonas reinhardtii demonstrated that mutations in peripheral stalk subunits (atpF) completely prevented ATP synthase function and accumulation .

The assembly process requires coordination between nuclear-encoded assembly factors and chloroplast-encoded subunits. Several assembly factors have been identified, including PROTEIN IN CHLOROPLAST ATPASE BIOGENESIS (PAB) and BIOGENESIS FACTOR REQUIRED FOR ATP SYNTHASE 1 (BFA1) .

How can recombinant atpI contribute to engineering efforts for enhanced photosynthetic efficiency?

Recombinant atpI offers opportunities for engineering ATP synthase to enhance photosynthetic efficiency:

Engineering approaches:

  • Modification of proton translocation efficiency:

    • Altering key residues in the proton path

    • Optimizing proton-to-ATP ratio

  • Stability enhancement:

    • Engineering thermostable variants through directed evolution

    • Improving tolerance to high light conditions

  • Redox regulation optimization:

    • Modifying regulatory domains to maintain ATP synthesis under variable conditions

    • Engineering variants with altered activation thresholds

  • Modulation of ATP synthase assembly:

    • Overexpression of limiting subunits to increase complex abundance

    • Engineering improved assembly factor interactions

Research in Chlamydomonas reinhardtii has demonstrated that modifications to ATP synthase regulation, particularly in the γ-subunit redox domain, affect photosynthetic performance under different environmental conditions . This suggests that engineering atpI and its interactions with other subunits could similarly impact ATP synthase function and photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.