Recombinant Ceratophyllum demersum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the order method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us; we will prioritize your request.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Ceratophyllum demersum (Rigid hornwort) (Coontail)
Target Names
cemA
Target Protein Sequence
MPKKKVLTPLPYLASIVFLPWWISLSFNKSLEPWVTNWWNTKQSEIFLNDIQEKNVLERF IELEELVLLDEMIKEYPETHIQKLRIGIHKETIQLVKMQNQNDIQIILHFSTNIITLTIL SGFFIMGNEELVILNSWVQEFFYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFAHNDQIISGLVSTFPVILDTILKYWIFHYLNRVSPSLVVIYHSMNE
Uniprot No.

Target Background

Function

This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is Chloroplast envelope membrane protein (cemA) and what is its role in Ceratophyllum demersum?

The Chloroplast envelope membrane protein (cemA) is a protein encoded by the chloroplast genome that localizes to the chloroplast envelope membrane in aquatic plants like Ceratophyllum demersum. Originally reported as a 34 kD protein, cemA is believed to be involved in CO₂ uptake mechanisms in the chloroplast . In C. demersum, cemA is part of a gene cluster that includes other important chloroplast genes such as atpA, psbI, and atpH, which encode subunits of the ATP synthase and photosystem II components .

The protein is encoded by a gene lacking its own promoter, with evidence suggesting that it forms part of a polycistronic transcription unit. This arrangement indicates that cemA expression is coordinated with other chloroplast genes, highlighting its integration into fundamental chloroplast processes .

How is recombinant cemA protein typically produced for research purposes?

Production of recombinant cemA protein typically follows these methodological steps:

  • Gene isolation and cloning: The cemA gene sequence is isolated from C. demersum chloroplast DNA and cloned into an appropriate expression vector.

  • Expression system selection: Common expression systems include:

    • Bacterial systems (E. coli)

    • Insect cell systems

    • Plant-based expression systems

  • Protein expression optimization: Key parameters include:

    • Induction conditions (temperature, inducer concentration)

    • Expression duration

    • Growth media composition

  • Purification strategy:

    • Affinity chromatography using tags (His-tag is common)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Quality control assessment:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • Mass spectrometry for structural verification

The final product is typically stored in a Tris-based buffer with 50% glycerol to maintain stability, and stored at -20°C for standard use or -80°C for extended storage .

What experimental models are suitable for studying cemA function?

Experimental ModelAdvantagesLimitationsApplications
Knockout/knockdown approaches in C. demersumDirect physiological relevanceTechnical difficulty with chloroplast transformationFunction elucidation
Heterologous expression in model organismsEasier genetic manipulationPotential lack of native interacting partnersProtein-protein interactions
In vitro reconstitution systemsControlled environmentMay not replicate complex cellular contextBiochemical activity assessment
Zebrafish embryo modelAllows for toxicity assessment and in vivo functionDifferent physiology from plantsSafety testing of extracts containing cemA
Aquatic organism exposure modelsDirectly relevant to ecological applicationsComplex to control all variablesEnvironmental impact studies

When designing experiments to study cemA function, researchers should consider the Fish Embryo Toxicity (FET) test using Danio rerio, which has been effectively employed to assess the safety of C. demersum extracts up to concentrations of 225 µg/ml . For environmental applications, studies with aquatic organisms like Macrobrachium nipponense, Corbicula fluminea, and Bellamya aeruginosa have successfully demonstrated cemA's role in biological processes .

What methodological approaches are most effective for isolating cemA from Ceratophyllum demersum?

Isolation of cemA protein from native Ceratophyllum demersum requires specialized protocols to maintain protein integrity while separating it from other chloroplast components:

  • Tissue preparation and chloroplast isolation:

    • Harvest fresh C. demersum material (preferably 2-3 week old culture)

    • Homogenize in isotonic buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA)

    • Filter through multiple layers of cheesecloth

    • Centrifuge at 1,000g for 5 minutes to pellet chloroplasts

  • Envelope membrane enrichment:

    • Resuspend chloroplasts in hypotonic buffer to release envelope membranes

    • Apply sucrose gradient centrifugation (0.3M to 1.0M sucrose)

    • Collect the envelope membrane fraction

  • Protein extraction and purification:

    • Solubilize membranes with appropriate detergents (0.5% n-dodecyl-β-D-maltoside)

    • Apply ion exchange chromatography

    • Follow with affinity chromatography if using tagged constructs

  • Verification of enrichment:

    • Calculate enrichment factor (EF) by comparing spectral counts in purified fraction versus crude extracts

    • EF = (Spectral count in envelope fraction/Total envelope proteins) ÷ (Spectral count in crude extract/Total crude extract proteins)

    • Genuine envelope proteins typically show EF > 5

This approach addresses the challenge of cemA's low abundance (chloroplast envelope proteins constitute only 1-2% of total chloroplast proteins) and helps distinguish genuine envelope proteins from contaminants.

How can researchers determine the functional role of cemA in mitigating microplastics uptake in aquatic organisms?

Recent research has revealed that C. demersum plays a significant role in alleviating microplastics (MPs) uptake in aquatic organisms, with cemA potentially contributing to this process . To investigate this function, researchers should employ the following methodological framework:

  • Experimental design:

    • Use a multifactorial approach with controlled exposure conditions

    • Establish treatment groups: C. demersum present vs. absent

    • Monitor multiple time points: exposure days (1, 3, 7) and depuration days (1, 3)

    • Include multiple aquatic species (e.g., M. nipponense, C. fluminea, B. aeruginosa)

  • Analytical parameters:

    • Quantify MPs in digestive and non-digestive tissues

    • Measure digestive enzyme activity

    • Assess oxidative stress markers

    • Evaluate energy metabolism enzyme activity

  • Molecular analysis of cemA involvement:

    • Compare wild-type C. demersum with cemA-silenced variants

    • Quantify cemA expression levels in relation to MP depuration efficiency

    • Perform protein-protein interaction studies to identify binding partners

  • Data interpretation framework:

    • Analyze species-specific responses

    • Determine time-dependent effects

    • Calculate depuration efficiency rates

What challenges exist in studying the interaction between cemA and other chloroplast proteins?

Investigating cemA interactions with other chloroplast proteins presents several methodological challenges:

  • Technical limitations:

    • Membrane protein solubilization without disrupting native interactions

    • Low abundance of cemA in total chloroplast proteome

    • Potential transient nature of some protein-protein interactions

  • Experimental approaches and their limitations:

ApproachStrengthsLimitationsMitigation Strategies
Co-immunoprecipitationCaptures in vivo complexesRequires specific antibodiesUse epitope-tagged recombinant proteins
Yeast two-hybridHigh-throughputHigh false positive rateValidate with secondary methods
Bimolecular fluorescence complementationVisualizes interactions in vivoPotential artifacts from protein fusionUse multiple fusion orientations
Crosslinking mass spectrometryCaptures transient interactionsComplex data analysisEmploy advanced computational algorithms
Cryo-electron microscopyHigh-resolution structural dataRequires highly purified samplesOptimize membrane protein preparation
  • Data integration challenges:

    • Reconciling conflicting results from different techniques

    • Distinguishing direct from indirect interactions

    • Correlating interaction data with functional outcomes

The study of cemA is further complicated by its location within a tetracistronic transcription unit alongside atpA, psbI, and atpH genes, making it difficult to isolate its specific interactions without affecting the expression of these other important chloroplast components .

What experimental designs are most appropriate for investigating cemA's potential anticancer properties?

Research has identified C. demersum extracts as having potential anticancer activities , and investigating cemA's specific contribution requires methodical experimental designs:

  • Preliminary screening approaches:

    • Compare anticancer activity of wild-type extracts vs. cemA-depleted extracts

    • Screen against multiple cancer cell lines of gastrointestinal tract origin

    • Use flow cytometry to assess apoptotic and necrotic cell populations

  • Mechanism elucidation studies:

    • Analyze cell cycle progression effects

    • Determine impact on apoptotic pathways (intrinsic vs. extrinsic)

    • Evaluate effects on cellular redox status

  • In vivo validation:

    • Zebrafish embryo models for preliminary toxicity assessment

    • Xenograft models using immunocompromised mice

    • Patient-derived organoids for translational relevance

  • Experimental controls:

    • Include targeted protein degradation approaches

    • Compare with established chemotherapeutic agents

    • Use non-cancerous cell lines to assess specificity

Current research demonstrates that C. demersum extracts increase the percentage of late apoptotic and necrotic cells in gastrointestinal cancer cells, with safety confirmed in zebrafish embryos up to 225 μg/ml . To specifically attribute these effects to cemA protein, researchers should employ purified recombinant protein in parallel with whole plant extracts.

How can proteomics approaches be used to study cemA in the context of the chloroplast envelope proteome?

Advanced proteomics strategies offer powerful tools for investigating cemA within the broader chloroplast envelope proteome:

  • Sample preparation optimization:

    • Employ differential centrifugation combined with sucrose gradient separation

    • Use multiple detergent solubilization approaches (mild to stringent)

    • Apply biochemical fractionation to enrich for envelope membranes

  • Mass spectrometry-based techniques:

    • Label-free quantitative proteomics for abundance estimation

    • Stable isotope labeling approaches for comparative studies

    • Data-independent acquisition for comprehensive proteome coverage

    • Targeted proteomics (PRM/MRM) for specific cemA detection

  • Data analysis framework:

    • Calculate enrichment factors to distinguish genuine envelope proteins

    • Apply stringent statistical filtering criteria

    • Perform clustering analysis to identify co-regulated proteins

    • Integrate with available genomic and transcriptomic datasets

  • Functional characterization:

    • Correlate cemA abundance with other envelope proteins

    • Identify potential interaction networks

    • Map post-translational modifications

Research has shown that chloroplast envelope proteins represent only 0.4% of the whole cell proteome, making specialized enrichment techniques essential . Using enrichment factor calculations helps differentiate genuine envelope proteins from contaminants—a critical step given that previous studies have identified 1,269 proteins in purified envelope fractions, of which only 462 could be confirmed as true envelope proteins .

What are the most reliable bioassays to measure cemA activity in vitro?

To accurately assess the biological activity of recombinant cemA protein, researchers should employ multiple complementary bioassays:

  • Functional assays:

    • Membrane transport assays to measure CO₂ uptake capability

    • Liposome reconstitution to assess membrane integration and function

    • ATP hydrolysis assays to evaluate energetic coupling

  • Interaction assays:

    • Surface plasmon resonance to quantify binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Microscale thermophoresis for interaction analysis in solution

  • Activity calculation:

    • Determine ED₅₀ (effective dose for 50% response)

    • Calculate specific activity using the formula:
      Specific activity (units/mg) = 1 × 10⁶ / ED₅₀ (ng/mL)

  • Validation approaches:

    • Positive and negative controls with known activity profiles

    • Internal standards for assay normalization

    • Multiple biological and technical replicates

When assessing activity in environmental applications, such as microplastics depuration, researchers should measure both direct cemA activity and downstream physiological responses in test organisms, including digestive enzyme activity, oxidative stress markers, and energy metabolism enzyme levels .

How can researchers address data contradictions when studying cemA expression across different environmental conditions?

When conflicting data arise in cemA expression studies under varying environmental conditions, researchers should implement a systematic approach:

  • Experimental design considerations:

    • Use factorial designs to simultaneously evaluate multiple variables

    • Implement time-course studies to capture dynamic responses

    • Include appropriate biological and technical replicates

    • Apply standardized reporting using typologically ordered tables for clarity

  • Data integration framework:

Data TypeAnalysis ApproachValidation MethodIntegration Strategy
TranscriptomicRNA-Seq, qRT-PCRNorthern blotCompare expression patterns across methods
ProteomicMass spectrometryWestern blotCorrelate protein and transcript levels
PhysiologicalFunctional assaysIndependent assaysLink molecular and phenotypic responses
EnvironmentalControlled variablesField validationAssess laboratory vs. natural conditions
  • Statistical approaches for resolving contradictions:

    • Meta-analysis across multiple studies

    • Bayesian inference models to incorporate prior knowledge

    • Machine learning to identify underlying patterns

    • Sensitivity analysis to identify critical parameters

  • Reporting guidelines:

    • Document all experimental conditions comprehensively

    • Present contradictory results transparently

    • Use data inventory tables to ensure complete data accounting

    • Employ concept-evidence tables to ground interpretations in empirical evidence

When examining the allelopathic effects of C. demersum, researchers have found contradictory results, with some studies showing inhibitory effects on seed development and radicle growth, while others demonstrate sensitivity of C. demersum to other aquatic plants like Hydrilla verticillata . These contradictions highlight the importance of standardized experimental approaches and thorough documentation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.