Recombinant Ceratophyllum demersum Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Biological Role in Cytochrome c Maturation

CcsA operates within the system II cytochrome c biogenesis pathway, which is conserved in cyanobacteria, plants, and certain bacteria . Key functions include:

  • Heme Transport: CcsA forms a complex with CcsB to translocate heme across membranes .

  • Thioether Bond Formation: Mediates covalent attachment of heme to apocytochrome c’s CXXCH motif via conserved cysteine residues .

  • Redox Regulation: Collaborates with thioredoxin-like proteins (e.g., CcsX) to maintain apocytochrome cysteines in a reduced state for ligation .

Structural studies reveal that the WWD domain and two periplasmic histidines (P-His1 and P-His2) coordinate heme at the active site, enabling stereospecific vinyl-thioether bond formation . Mutagenesis of residues like W828 and W833 disrupts heme attachment, underscoring their functional necessity .

Expression and Purification

The protein is expressed in E. coli with >85% purity, as confirmed by SDS-PAGE . Its recombinant form retains enzymatic activity, enabling in vitro reconstitution of cytochrome c synthesis .

Research Applications

  • Mechanistic Studies: Used to dissect heme trafficking and attachment in system II pathways .

  • Comparative Analysis: Contrasted with mitochondrial cytochrome c synthase (HCCS) to elucidate evolutionary divergences .

  • Biotechnological Tool: Facilitates the production of functional c-type cytochromes for metabolic engineering .

Functional Mutations

  • W828A/W833A: Abolish heme ligation, confirming the WWD domain’s role .

  • Cysteine Substitutions: Enable crosslinking to heme vinyl groups, mapping interaction sites .

Domain/MotifFunctionImpact of Mutation
WWD motifHeme coordinationLoss of synthetase activity
P-His1/P-His2Iron ligationDisrupted heme redox potential
Transmembrane helicesHeme transport channelBlocked heme export

Evolutionary and Ecological Context

While Ceratophyllum demersum is an invasive aquatic plant , its ccsA protein shares functional homology with cyanobacterial and proteobacterial orthologs . This conservation highlights system II’s ancient origin and adaptability across photosynthetic organisms .

Future Directions

  • Structural Dynamics: Resolving conformational changes during heme transfer.

  • Engineering Applications: Optimizing ccsA for synthetic biology platforms requiring cytochrome c assembly .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag whenever possible.
Synonyms
ccsA; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Ceratophyllum demersum (Rigid hornwort) (Coontail)
Target Names
ccsA
Target Protein Sequence
MIFETLEHILTHISFSIISIVILIHFMALLGHEIVGLRDSSEKGMIATFFCITGLLVSRW SYSGHFPLSNLYESLMFLSWSFSIIHMVPYFGNHKNDLSVITNPSAIFTQGFATSGLLTE MHQSSILVPALQSQWLMMHVSMMLLSYAALLCGSLLSVALLVITFRQSIDLFFKRDQLLT GGFSFGEIQYLNEKRSVLQNTSFLSFKNYHRYQLTRRLDHWSYRIISLGFTFLTIGILSG AVWANEAWGSYWNWDPKETWAFITWTVFAIYLHTRTNQNFQSANSAIVASMGFLIIWICY FGVNLLGIGLHSYGSFISN
Uniprot No.

Target Background

Function
CcsA plays a crucial role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) by facilitating the heme attachment step.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ceratophyllum demersum and why is it relevant for molecular biology research?

Ceratophyllum demersum (hornwort) is a perennial submerged macrophyte widespread in Eurasia and North America. It is notable for not forming roots but attaching to bottom sediments via modified leaves. Its research relevance stems from its high shade tolerance, resistance to disturbance in water environments, and ability to thrive in both natural and artificial water bodies including anthropogenic reservoirs . The plant produces various bioactive compounds with allelopathic effects on other aquatic organisms, including negative effects on some plants and algae, while stimulating growth in certain eukaryotic microorganisms like Chlorella and Scenedesmus . Its rich biochemical profile and adaptability make it an interesting model for studying aquatic plant molecular biology.

What is the role of cytochrome c biogenesis proteins in cellular function?

Cytochrome c biogenesis proteins are essential components involved in the complex pathway of heme delivery and attachment to cytochrome c, which is critical for electron transport chains and energy production in cells. The System I pathway (found in many bacteria and plant mitochondria) involves several Ccm proteins working in coordination to transport and attach heme to apocytochrome c. Specifically, proteins like CcmC act as heme chaperones that bind heme via conserved histidine residues (such as H68 and H192) and transfer it to CcmE . This process involves an ATP-dependent mechanism where the ABC transporter complex CcmA₂B₁C₁ facilitates the release of holo-CcmE for the final steps of cytochrome c assembly . The ccsA protein is part of System II and performs analogous functions in cyanobacteria, some prokaryotes, and chloroplasts, playing a crucial role in cytochrome maturation.

What molecular techniques are necessary for isolating genetic material from Ceratophyllum demersum?

Isolation of genetic material from Ceratophyllum demersum requires specific protocols to address the challenges presented by aquatic plants. Recommended methods include:

  • Sample collection and preparation: Harvest fresh plant material, clean thoroughly to remove epiphytes and debris, and immediately flash-freeze in liquid nitrogen to preserve nucleic acid integrity.

  • Nucleic acid extraction: Use modified CTAB (cetyltrimethylammonium bromide) extraction buffer supplemented with higher concentrations of PVP (polyvinylpyrrolidone) and β-mercaptoethanol to handle the high polysaccharide and polyphenol content typical of aquatic plants .

  • DNA/RNA purification: Employ silica column-based purification with additional washing steps to remove contaminants specific to aquatic environments.

  • Quality assessment: Verify nucleic acid quality through spectrophotometric analysis (A260/A280 ratio) and gel electrophoresis to ensure suitability for downstream applications like PCR amplification and cloning.

  • Storage consideration: Store extracted DNA/RNA at -80°C with appropriate stabilizers to prevent degradation from plant nucleases.

How can the ccsA gene be identified and isolated from Ceratophyllum demersum?

Identification and isolation of the ccsA gene from Ceratophyllum demersum requires a multi-step approach:

  • Bioinformatic analysis: Begin by conducting homology searches using known ccsA sequences from related aquatic plants or algae against available Ceratophyllum demersum transcriptomic or genomic databases to identify candidate sequences.

  • Primer design: Design degenerate primers targeting conserved regions of the ccsA gene based on multiple sequence alignments of ccsA homologs from phylogenetically related species.

  • PCR amplification: Use gradient PCR with the degenerate primers on genomic DNA or cDNA from Ceratophyllum demersum to amplify the candidate gene region.

  • RACE (Rapid Amplification of cDNA Ends): For obtaining full-length cDNA, perform 5' and 3' RACE reactions to capture the complete coding sequence including UTRs.

  • Cloning and sequencing: Clone the amplified fragments into appropriate vectors following standard recombinant DNA techniques , sequence the inserts, and assemble the complete gene sequence.

  • Sequence verification: Confirm the identity of the isolated gene through comparative analysis with known ccsA sequences, focusing on conserved functional domains and motifs characteristic of cytochrome c biogenesis proteins .

  • Functional annotation: Analyze the predicted protein sequence for transmembrane domains, heme-binding motifs, and other structural features typical of ccsA proteins to validate its identification.

What are the key conserved domains in ccsA proteins that should be preserved when creating recombinant constructs?

When designing recombinant constructs of ccsA, preserving these key conserved domains is essential for maintaining functionality:

  • Transmembrane domains: ccsA typically contains multiple transmembrane spanning regions that anchor the protein in the membrane, which are crucial for establishing the correct topology.

  • Tryptophan-rich motif: Similar to what has been observed in related cytochrome c biogenesis proteins like CcmC, a tryptophan-rich motif (e.g., WWxWD) is often critical for heme binding and transfer. Mutations in this region can significantly inhibit heme incorporation capabilities .

  • Histidine residues: Conserved histidine residues (analogous to H68 and H192 in CcmC) likely serve as axial ligands for heme binding and are essential for function. These should never be altered in recombinant constructs .

  • ATP-binding cassette: If the ccsA functions as part of an ABC transporter system, conserving the Walker A motif responsible for ATP binding and hydrolysis is crucial, as mutations in this region (like K41D in CcmA) can abolish function .

  • Periplasmic domains: These regions often contain residues that interact with other components of the cytochrome c maturation system and the recipient apocytochrome.

Sequence verification through multiple alignments with homologous proteins can identify these conserved regions before designing any recombinant constructs.

What expression systems are most suitable for recombinant Ceratophyllum demersum ccsA production?

The optimal expression systems for recombinant Ceratophyllum demersum ccsA production depend on research objectives:

Bacterial Systems (E. coli):

  • Advantages: Rapid growth, high yield, cost-effective, and well-established protocols

  • Limitations: Lacks eukaryotic post-translational modifications; membrane proteins like ccsA often form inclusion bodies

  • Recommended strains: C41(DE3) or C43(DE3) specially designed for membrane protein expression

  • Considerations: Use fusion tags (MBP, SUMO) to enhance solubility; consider periplasmic targeting with appropriate signal peptides

Yeast Systems (Pichia pastoris):

  • Advantages: Eukaryotic processing capabilities, high-density culture possible, strong inducible promoters

  • Limitations: Longer expression time than bacteria

  • Considerations: Codon optimization for yeast expression; use of methanol-inducible AOX1 promoter

Insect Cell Systems:

  • Advantages: More complex post-translational modifications, better for membrane proteins

  • Limitations: More expensive, technically demanding

  • Considerations: Baculovirus expression vector system; use of signal peptides optimized for insect cells

Mammalian Systems (CHO cells):

  • Advantages: Native-like post-translational modifications, ideal for complex proteins

  • Limitations: Highest cost, lowest yield, most technically challenging

  • Considerations: Only necessary if authentic eukaryotic modifications are crucial for function

Plant-Based Expression Systems:

  • Advantages: Species-relevance, potentially more authentic processing for a plant protein

  • Limitations: Lower yields, longer development time

  • Considerations: Transient expression in Nicotiana benthamiana; chloroplast transformation systems

The choice should be guided by whether functional studies require authentically processed protein (favoring plant-based or yeast systems) or if structural studies requiring higher yields are planned (favoring bacterial systems with optimization).

What are the optimal vector design strategies for expressing ccsA in heterologous systems?

Optimal vector design for ccsA expression requires careful consideration of multiple elements:

  • Promoter selection:

    • For bacteria: T7 promoter for high expression or arabinose-inducible promoter (PBAD) for more controlled expression

    • For yeast: Methanol-inducible AOX1 or constitutive GAP promoter

    • For mammalian cells: CMV or EF1α promoters for strong expression

  • Signal peptide optimization:

    • Select signal peptides with proven efficiency in the host system

    • Consider testing multiple signal peptides empirically (native plant signal peptide vs. host-optimized ones)

    • Modify the primary structure of the signal peptide sequence based on host preferences

  • Codon optimization:

    • Adapt the ccsA sequence to the codon bias of the expression host

    • Avoid rare codons, negative cis-acting elements, and mRNA secondary structures

    • Balance GC content to improve mRNA stability and translation efficiency

  • Fusion tags strategy:

    • N-terminal tags: 6xHis, MBP, or SUMO to improve solubility and enable purification

    • C-terminal tags: Consider impact on transmembrane topology and function

    • Include specific protease cleavage sites (TEV, PreScission) for tag removal

  • Vector backbone elements:

    • Include appropriate selection markers for the host (antibiotic resistance for bacteria, auxotrophic markers for yeast)

    • Optimize the ribosome binding site or Kozak sequence for efficient translation initiation

    • Consider adding elements for genomic integration in eukaryotic systems

  • Expression control:

    • Include inducible elements for temporal control of expression

    • Consider dual promoter systems for coordinate expression with interacting partners

  • Sequence verification elements:

    • Include restriction sites for diagnostic digestion

    • Design for easy sequencing verification of the entire construct

Each of these elements should be optimized based on the specific host system selected for expression.

What are the key challenges in expressing membrane proteins like ccsA and how can they be addressed?

Expressing membrane proteins like ccsA presents several challenges that require specific strategies:

Challenge 1: Protein misfolding and aggregation

  • Solution: Lower induction temperature (16-20°C) to slow expression and allow proper folding

  • Solution: Use specialized strains like C41(DE3) or Lemo21(DE3) designed for membrane protein expression

  • Solution: Add chemical chaperones (glycerol, arginine) to the culture medium to enhance proper folding

Challenge 2: Cytotoxicity to host cells

  • Solution: Use tightly regulated, inducible expression systems

  • Solution: Titrate inducer concentration to find optimal expression level that balances yield and toxicity

  • Solution: Consider using lower-copy-number vectors to reduce basal expression

Challenge 3: Incorrect membrane insertion

  • Solution: Ensure proper signal recognition particle (SRP) recognition using optimized signal sequences

  • Solution: Consider fusion with well-characterized membrane protein domains that serve as "membrane anchors"

  • Solution: Test expression in multiple hosts to find optimal membrane integration system

Challenge 4: Low yield

  • Solution: Scale up culture volume and optimize growth conditions (media composition, aeration)

  • Solution: Implement fed-batch or high-density culture techniques

  • Solution: Optimize codon usage and mRNA stability through sequence engineering

Challenge 5: Protein extraction and stability

  • Solution: Screen multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

  • Solution: Add stabilizers (glycerol, specific lipids) during extraction and purification

  • Solution: Consider extracting as protein-lipid nanodiscs or styrene maleic acid lipid particles (SMALPs)

Challenge 6: Purification efficiency

  • Solution: Optimize tag position (N- or C-terminal) based on predicted topology

  • Solution: Implement two-step purification protocols (affinity chromatography followed by size exclusion)

  • Solution: Consider on-column detergent exchange during purification

Each of these challenges requires empirical optimization for the specific membrane protein being studied, as the optimal conditions can vary significantly between different proteins.

What purification strategies are most effective for recombinant ccsA protein?

Purification of recombinant ccsA protein requires specialized approaches for membrane proteins:

  • Membrane preparation

    • Harvest cells and disrupt by sonication, French press, or bead-beating

    • Remove cellular debris by low-speed centrifugation (5,000-10,000g)

    • Isolate membrane fraction through ultracentrifugation (100,000g)

    • Wash membranes to remove peripheral proteins

  • Solubilization screening

    • Test multiple detergents systematically:

      • Mild detergents: DDM, LMNG, digitonin

      • Intermediate detergents: UDM, DM

      • Harsh detergents (if needed): OG, Triton X-100

    • Optimize detergent concentration, temperature, and time

    • Consider detergent mixtures for improved extraction efficiency

  • Affinity purification

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Include detergent at concentrations above CMC in all buffers

    • Add glycerol (10-15%) and reducing agents to maintain stability

    • Consider on-column detergent exchange if beneficial

  • Secondary purification

    • Size exclusion chromatography (SEC) to separate different oligomeric states

    • Ion exchange chromatography if theoretical pI allows

    • Affinity chromatography with a second tag if dual-tagged construct was used

  • Alternative approaches

    • Styrene maleic acid lipid particles (SMALPs) extraction to maintain native lipid environment

    • Nanodisc reconstitution for increased stability and functionality

    • Amphipol exchange for detergent-free handling

  • Quality assessment

    • SDS-PAGE and western blotting to verify purity and identity

    • Circular dichroism to assess secondary structure integrity

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

    • Mass spectrometry to confirm protein identity and detect modifications

  • Optimization table for solubilization conditions:

DetergentConcentration RangeTemperatureTimeComments
DDM0.5-2%4°C1-2 hoursGentle, good first choice
LMNG0.1-1%4°C1-2 hoursIncreased stability over DDM
Digitonin0.5-2%4°C2-4 hoursNatural detergent, often preserves interactions
UDM0.5-2%4°C1 hourIntermediate extraction efficiency
OG1-2%4°C or RT0.5-1 hourHarsh but crystallization-friendly
SMA2-3%RT2 hoursPolymer for native nanodiscs

Successful purification typically requires iterative optimization specific to the particular protein construct being studied.

What experimental approaches can determine if recombinant ccsA is correctly folded and functional?

Determining the correct folding and functionality of recombinant ccsA requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal shift assays to measure protein stability and proper folding

    • Limited proteolysis to probe for accessible cleavage sites indicating proper folding

    • Intrinsic tryptophan fluorescence to assess tertiary structure integrity, particularly relevant given the tryptophan-rich motif essential in cytochrome c biogenesis proteins

  • Heme binding capacity:

    • UV-visible spectroscopy to detect characteristic Soret and Q bands of bound heme

    • Resonance Raman spectroscopy to examine heme environment and coordination

    • Heme titration assays with quantitative spectroscopic monitoring

    • Isothermal titration calorimetry to determine heme binding affinity and thermodynamics

  • Functional reconstitution:

    • Liposome reconstitution assays with fluorescent heme analogs to track transport

    • Proteoliposome-based activity assays measuring heme transfer to acceptor proteins

    • Co-expression with partner proteins from the cytochrome c maturation system to assess functional interactions

  • In vivo complementation:

    • Expression in ccsA-deficient model organisms to test functional restoration

    • Measurement of cytochrome c levels in complemented strains

    • Oxygen consumption or photosynthetic efficiency assays in complemented systems

  • Interaction studies:

    • Pull-down assays to verify binding to known protein partners

    • Surface plasmon resonance to measure binding kinetics with interacting proteins

    • Crosslinking mass spectrometry to identify interaction interfaces

  • ATP hydrolysis assay (if applicable):

    • Malachite green assay to quantify inorganic phosphate release

    • Coupled enzyme assays (NADH oxidation) for continuous monitoring of ATP hydrolysis

    • Comparison of ATPase activity with site-directed mutants of key residues in ATP-binding sites

The combination of these approaches provides a comprehensive assessment of both structural integrity and functional capacity.

How can researchers investigate the heme binding and transfer mechanisms of ccsA?

Investigating heme binding and transfer mechanisms of ccsA requires sophisticated biophysical and biochemical techniques:

  • Site-directed mutagenesis studies:

    • Generate mutations in putative heme-binding residues (histidines, WWxWD motif) based on homology to related proteins like CcmC

    • Create a library of mutants with alterations to conserved residues in transmembrane domains

    • Assess the impact of mutations on heme binding and transfer through spectroscopic and functional assays

  • Time-resolved spectroscopy:

    • Use stopped-flow spectroscopy to measure kinetics of heme binding

    • Apply resonance Raman spectroscopy to characterize the heme environment before and after transfer

    • Utilize time-resolved fluorescence to monitor conformational changes during the binding/transfer process

  • Advanced structural techniques:

    • Cryo-electron microscopy of the protein reconstituted in nanodiscs

    • NMR studies of isotopically labeled protein domains with heme

    • Hydrogen-deuterium exchange mass spectrometry to identify regions undergoing conformational changes upon heme binding

  • Reconstitution systems:

    • Develop in vitro reconstitution systems with purified components of the cytochrome c maturation pathway

    • Use fluorescently labeled heme analogs to track transfer between proteins

    • Measure transfer efficiency under varying conditions (pH, redox state, ATP concentration)

  • Redox potential measurements:

    • Determine the redox potential of bound heme using spectroelectrochemistry

    • Investigate how mutations affect the redox properties of the bound heme

    • Analyze the relationship between redox potential and transfer efficiency

  • Computational approaches:

    • Molecular dynamics simulations of heme binding and protein-protein interactions

    • Quantum mechanical calculations of heme coordination chemistry

    • Molecular docking to predict interaction interfaces with partner proteins

  • Experimental design for heme transfer kinetics:

ExperimentParameter MeasuredControlsExpected Outcome
Stopped-flow UV-VisHeme binding kineticsFree heme, denatured proteinMultiphasic binding curve
Fluorescence quenchingProtein conformational changesNon-heme binding mutantSignal change upon binding
FRET assayInter-protein transferNo-ATP control, Walker A mutantDistance-dependent energy transfer
Hydrogen-deuterium exchangeConformational dynamicsApo vs. holo proteinProtected regions in heme-bound state

These approaches collectively provide mechanistic insights into how ccsA binds and transfers heme during cytochrome c maturation.

How does the function of ccsA in Ceratophyllum demersum compare with homologous proteins in other photosynthetic organisms?

Comparative analysis of ccsA across photosynthetic organisms reveals evolutionary adaptations to different environments:

Ceratophyllum demersum, as a submerged aquatic plant, likely shows specific adaptations in its cytochrome c biogenesis machinery. While direct comparative data for ccsA is limited, research on cytochrome c biogenesis systems provides insights into potential differences:

  • Structural adaptations:

    • Submerged aquatic plants like Ceratophyllum demersum often show adaptations to low-light and hypoxic conditions

    • The ccsA protein might contain modified transmembrane domains optimized for the unique membrane composition found in aquatic plants

    • Potential differences in substrate specificity related to the specific c-type cytochromes present in Ceratophyllum

  • System comparison across lineages:

    • Green plants typically utilize System I in mitochondria and System II in chloroplasts

    • Cyanobacteria employ System II exclusively

    • Land plants and aquatic plants show divergence in specific components reflecting their environmental adaptations

  • Functional conservation:

    • Core heme-binding domains likely show high conservation across diverse photosynthetic organisms

    • The WWxWD motif found in related cytochrome biogenesis proteins appears critical across systems

    • Histidine residues serving as axial ligands for heme are typically conserved across lineages

  • Regulatory differences:

    • Ceratophyllum, adapted to fluctuating underwater light conditions, may show regulatory adaptations in cytochrome biogenesis

    • Potential differences in expression patterns, protein turnover, or activity regulation compared to terrestrial plants

    • Possible co-evolution with specific cytochrome c variants optimized for aquatic photosynthesis

  • Interaction partners:

    • Differences in auxiliary proteins that interact with ccsA between aquatic and terrestrial plants

    • Potential adaptations in chaperone interactions related to the aquatic environment

The comparative analysis suggests that while core biochemical functions are preserved, significant adaptations may exist in regulatory mechanisms, efficiency, and environmental responsiveness of the ccsA protein in Ceratophyllum demersum.

What role might post-translational modifications play in regulating ccsA function in Ceratophyllum demersum?

Post-translational modifications (PTMs) likely play crucial regulatory roles in ccsA function in Ceratophyllum demersum:

  • Phosphorylation:

    • Potential phosphorylation sites in cytosolic domains may regulate activity in response to environmental signals

    • Kinase-mediated phosphorylation could modulate protein-protein interactions with other components of the cytochrome c maturation system

    • Phosphorylation status might change in response to light conditions, oxygen availability, or nutrient status

  • Redox-based modifications:

    • Cysteine residues may undergo oxidation, glutathionylation, or nitrosylation as regulatory mechanisms

    • These modifications could act as molecular switches responding to the redox state of the chloroplast

    • Particularly relevant for Ceratophyllum demersum, which experiences fluctuating oxygen levels in its aquatic environment

  • Glycosylation:

    • If present, N-linked glycosylation in luminal domains could affect protein stability and folding

    • The glycosylation pattern might differ between Ceratophyllum and terrestrial plants due to aquatic adaptations

    • Analysis of predicted glycosylation sites could provide insights into conservation across species

  • Proteolytic processing:

    • Potential cleavage of N-terminal transit peptides during chloroplast import

    • Regulated proteolysis might serve as an additional control mechanism for ccsA activity

    • The processing machinery might show adaptations specific to aquatic plants

  • Lipid modifications:

    • Possible palmitoylation or other lipid modifications affecting membrane association

    • These modifications could influence the protein's localization within the thylakoid membrane

    • Differences in lipid composition between aquatic and terrestrial plant membranes might necessitate specific adaptations

  • Methodological approaches to study PTMs:

    • Mass spectrometry-based phosphoproteomics to identify phosphorylation sites

    • Site-directed mutagenesis of predicted modification sites followed by functional assays

    • In vitro modification assays with recombinant protein and relevant modifying enzymes

    • Comparison of modification patterns under different environmental conditions relevant to aquatic plants

Understanding these modifications could provide insights into how Ceratophyllum demersum adapts its cytochrome c biogenesis machinery to its specific ecological niche.

How can CRISPR-Cas9 gene editing be optimized for studying ccsA function in Ceratophyllum demersum?

Optimizing CRISPR-Cas9 gene editing for studying ccsA in Ceratophyllum demersum requires addressing several technical challenges specific to aquatic plants:

  • Delivery system optimization:

    • Develop protoplast isolation protocols specific to Ceratophyllum demersum tissues

    • Optimize PEG-mediated transformation parameters for aquatic plant protoplasts

    • Explore Agrobacterium-mediated transformation with vacuum infiltration adapted for submerged tissues

    • Test biolistic delivery parameters optimized for hydrated tissues

  • Guide RNA design strategy:

    • Identify unique PAM sites within the ccsA gene sequence

    • Design multiple sgRNAs targeting different exons, particularly conserved functional domains

    • Screen for off-target effects in silico using the Ceratophyllum genome or related species

    • Create gRNA pools for multiplexed targeting to increase editing efficiency

  • Cas9 variant selection:

    • Test high-fidelity Cas9 variants (eSpCas9, HiFi Cas9) to minimize off-target effects

    • Consider base editors for precise nucleotide changes in functional studies

    • Evaluate prime editors for targeted nucleotide replacements without double-strand breaks

    • Optimize codon usage of Cas9 for expression in Ceratophyllum

  • Regeneration and selection system:

    • Develop tissue culture protocols specific for Ceratophyllum regeneration from edited cells

    • Optimize selection markers suitable for aquatic plant transformation

    • Establish efficient screening methods for identifying edited plants

    • Create reporter systems for visualizing successful editing events

  • Experimental design table for CRISPR editing optimization:

ParameterVariables to TestMeasurement MethodSuccess Criteria
Protoplast viabilityEnzyme concentration, digestion timeFDA staining, cell counting>70% viable protoplasts
Transformation efficiencyDNA concentration, PEG percentageReporter gene expression>10% transformation rate
Editing efficiencygRNA design, Cas9:gRNA ratioT7E1 assay, sequencing>20% editing at target site
Off-target effectsDifferent Cas9 variantsWhole genome sequencing<1% off-target modifications
Regeneration rateHormone combinations, culture conditionsPlant regeneration frequency>5% regeneration of edited cells
  • Phenotypic analysis approaches:

    • Develop assays for cytochrome c content and maturation in edited plants

    • Measure photosynthetic parameters to assess functional impacts

    • Analyze growth characteristics under different environmental conditions

    • Compare stress responses between wild-type and edited plants

  • Complementary approaches:

    • RNAi-based knockdown as an alternative if CRISPR editing proves challenging

    • Overexpression studies with modified ccsA variants

    • Heterologous expression of Ceratophyllum ccsA in model systems

These optimized approaches would enable precise genetic manipulation to understand ccsA function in this aquatic plant system.

How might environmental factors influence the expression and function of ccsA in Ceratophyllum demersum?

Environmental factors likely have significant impacts on ccsA expression and function in Ceratophyllum demersum, reflecting the plant's adaptation to aquatic habitats:

  • Light intensity and quality:

    • Underwater light environments have reduced intensity and shifted spectral composition

    • Research indicates Ceratophyllum demersum has high shade tolerance, suggesting specialized adaptations in photosynthetic machinery

    • Expression of ccsA may be upregulated under low light conditions to enhance cytochrome maturation for efficient light harvesting

    • The red:far-red ratio underwater likely influences photosynthetic gene expression including cytochrome biogenesis genes

  • Oxygen availability:

    • Dissolved oxygen fluctuates diurnally in aquatic environments

    • Hypoxic conditions may trigger alterations in cytochrome c biogenesis to maintain electron transport efficiency

    • Potential post-translational modifications of ccsA in response to oxygen levels

    • Adaptation to periodic hypoxia may involve specialized regulatory mechanisms for cytochrome maturation

  • Water chemistry effects:

    • pH fluctuations influence protein function and stability

    • Research shows Ceratophyllum can develop in both natural and artificial water bodies with varying chemistry

    • Potential adaptations in ccsA function to accommodate broader pH ranges in aquatic environments

    • Mineral availability (particularly iron for heme synthesis) directly impacts cytochrome biogenesis

  • Seasonal variations:

    • Temperature changes affect membrane fluidity and protein function

    • Potential seasonal expression patterns of ccsA correlating with growth cycles

    • Adaptation to cold water temperatures may involve modifications to protein stability

  • Anthropogenic influences:

    • Ceratophyllum demersum can be harvested from artificial anthropogenic reservoirs, indicating tolerance to human-altered environments

    • Potential adaptations in cytochrome biogenesis machinery to manage oxidative stress from pollutants

    • Expression changes in response to nutrient enrichment (eutrophication)

  • Allelopathic interactions:

    • Ceratophyllum produces compounds affecting other organisms, suggesting complex chemical ecology

    • Potential coordination between secondary metabolite production and energy metabolism via cytochrome systems

    • Co-regulation of allelopathic compound synthesis and cytochrome biogenesis under stress conditions

Understanding these environmental influences provides insights into the ecological adaptation of cytochrome c biogenesis in aquatic plants and informs experimental design for both laboratory and field studies.

What insights could comparative genomic analysis of ccsA across aquatic plant species provide?

Comparative genomic analysis of ccsA across aquatic plant species would yield valuable insights into evolutionary adaptation and functional specialization:

  • Evolutionary trajectories:

    • Phylogenetic analysis of ccsA sequences could reveal divergence patterns between terrestrial and aquatic lineages

    • Identification of aquatic plant-specific conserved motifs indicating adaptation to underwater environments

    • Detection of positive selection signatures in specific domains suggesting functional innovation

    • Dating of key evolutionary events in relation to habitat transitions between land and water

  • Structural adaptations:

    • Comparison of transmembrane domains across species may reveal adaptations to different membrane compositions

    • Analysis of substrate binding sites could indicate specialization for specific cytochrome c variants

    • Identification of lineage-specific insertions or deletions related to functional differences

    • Correlation between protein structure and ecological niches (shallow vs. deep water, marine vs. freshwater)

  • Regulatory element evolution:

    • Analysis of promoter regions could reveal different environmental response elements

    • Identification of regulatory innovations related to aquatic life

    • Characterization of transcription factor binding sites specific to aquatic plant lineages

    • Comparison of alternative splicing patterns across species

  • Coevolution patterns:

    • Analysis of coevolution between ccsA and its interaction partners in the cytochrome maturation pathway

    • Correlation between ccsA sequence features and photosynthetic adaptations

    • Detection of compensatory mutations maintaining protein-protein interactions

    • Identification of correlated evolutionary rates with other components of electron transport systems

  • Horizontal gene transfer (HGT) events:

    • Assessment of potential HGT events from cyanobacteria or other aquatic organisms

    • Identification of mosaic gene structures indicating recombination events

    • Comparative analysis of chloroplast vs. nuclear-encoded cytochrome maturation systems

    • Detection of adaptation signatures following gene transfer events

  • Methodological framework for comparative analysis:

Analysis TypeTools/MethodsExpected OutcomesBiological Insights
Sequence alignmentMAFFT, T-CoffeeConserved vs. variable regionsFunctional domain identification
Phylogenetic analysisRAxML, MrBayesEvolutionary relationshipsAdaptation to aquatic environments
Selection analysisPAML, HyPhySites under positive selectionAdaptive mutations
Structural predictionAlphaFold, SWISS-MODEL3D structural differencesFunctional specialization
Promoter analysisMEME, JASPARRegulatory element differencesEnvironmental response mechanisms
Synteny analysisMCScanX, SynMapGene neighborhood conservationGenome rearrangements

This comprehensive comparative approach would provide a foundation for understanding how cytochrome c biogenesis has evolved in aquatic plants and inform targeted functional studies of ccsA in Ceratophyllum demersum.

What are the most promising applications of research on recombinant Ceratophyllum demersum ccsA?

Research on recombinant Ceratophyllum demersum ccsA offers several promising applications spanning basic science to biotechnology:

  • Fundamental understanding of cytochrome biogenesis:

    • Elucidation of species-specific adaptations in heme delivery pathways

    • Insights into the evolution of photosynthetic electron transport chains

    • Understanding post-translational regulation mechanisms in aquatic plant proteins

    • Comparative analysis with terrestrial plant systems to identify aquatic adaptations

  • Biotechnological applications:

    • Engineering enhanced photosynthetic efficiency in crop plants by optimizing cytochrome maturation

    • Development of bio-sensors based on heme-binding domains for environmental monitoring

    • Design of synthetic electron transport chains with modified components for bioenergy applications

    • Creation of plant-based expression systems optimized for membrane protein production

  • Environmental applications:

    • Better understanding of aquatic plant physiology for phytoremediation technologies

    • Ceratophyllum demersum has demonstrated anticancer activity, suggesting bioactive compounds that may relate to its unique metabolism

    • Engineering plants with enhanced tolerance to fluctuating environments based on insights from aquatic adaptations

    • Development of biomarkers for ecological status assessment in aquatic ecosystems

  • Methodological advances:

    • Optimization of recombinant protein expression from aquatic plants

    • Development of new tools for membrane protein solubilization and purification

    • Creation of aquatic plant model systems for synthetic biology applications

    • Refinement of gene editing technologies for non-model aquatic species

  • Integrative research approaches:

    • Combining structural biology, biochemistry, and ecology for comprehensive protein function studies

    • Systems biology modeling of electron transport chain assembly and regulation

    • Eco-evolutionary analysis of protein adaptation to aquatic environments

    • Multi-omics integration to understand cytochrome biogenesis in environmental context

These diverse applications highlight the value of studying specialized proteins from non-model organisms like Ceratophyllum demersum, bridging fundamental research with practical applications in biotechnology and environmental science.

What technical barriers remain in studying ccsA function and how might they be overcome?

Several technical barriers currently limit comprehensive understanding of ccsA function in Ceratophyllum demersum, each requiring innovative approaches:

  • Genome availability limitations:

    • Barrier: Incomplete or unavailable genomic data for Ceratophyllum demersum

    • Solution: Generate high-quality genome assembly using long-read sequencing technologies (PacBio, Oxford Nanopore)

    • Solution: Develop transcriptome resources through RNA-Seq under various environmental conditions

    • Solution: Utilize comparative genomics with related aquatic plants to identify conserved regions

  • Transformation challenges:

    • Barrier: Lack of established transformation protocols for Ceratophyllum

    • Solution: Adapt protocols from other aquatic plants like Lemna or Spirodela

    • Solution: Develop tissue-specific transient expression systems

    • Solution: Explore cell-free expression systems for functional studies of the protein

  • Protein expression and purification difficulties:

    • Barrier: Membrane proteins like ccsA are notoriously difficult to express and purify

    • Solution: Design chimeric constructs with well-expressed membrane proteins

    • Solution: Explore novel detergents and nanodiscs specifically optimized for plant membrane proteins

    • Solution: Develop split-protein approaches to express soluble domains separately for specific studies

  • Functional assay limitations:

    • Barrier: Complex nature of heme transfer making it difficult to monitor in vitro

    • Solution: Develop fluorescent or bioluminescent reporter systems for heme binding and transfer

    • Solution: Create reconstituted systems with purified components of the cytochrome c maturation pathway

    • Solution: Utilize advanced imaging techniques to visualize protein-protein interactions in situ

  • Environmental complexity:

    • Barrier: Laboratory conditions may not reflect the complex environment of aquatic plants

    • Solution: Develop controlled microcosm systems that better simulate natural conditions

    • Solution: Implement field-based expression studies using portable molecular biology tools

    • Solution: Use environmental metabolomics to correlate protein function with ecological parameters

  • Methodological integration table:

BarrierCurrent LimitationInnovative ApproachExpected Outcome
Genomic resourcesIncomplete sequence dataLong-read sequencing + RNA-SeqComplete gene model with regulatory elements
Protein structureMembrane protein challengesAlphaFold2 + experimental validationReliable structural model for functional studies
In vivo analysisLack of transgenic systemsViral vectors + CRISPR deliveryTargeted genetic manipulation
Protein interactionsComplex multiprotein systemProximity labeling + mass spectrometryComprehensive interactome map
Environmental relevanceLab vs. field disconnectMulti-site comparative transcriptomicsEcologically relevant expression patterns

Overcoming these barriers requires interdisciplinary approaches combining molecular biology, structural biology, biochemistry, and ecology, potentially yielding comprehensive insights into the function and adaptation of ccsA in aquatic environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.