Recombinant Ceratophyllum demersum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction

NAD(P)H-quinone oxidoreductase (NQO1) is an intracellular enzyme that catalyzes the reduction of quinones and a variety of other compounds, preventing the production of reactive semiquinones . The enzyme functions with equal efficiency with NADH and NADPH cofactors, requiring a tightly bound FAD cofactor for its catalytic activity . Ceratophyllum demersum, also known as hornwort, is a rootless macrophyte that absorbs nutrients through its leaves .

Function and Biological Role of NQO1

NQO1 has several biological roles, including:

  • Reduction and activation of quinone compounds and their derivatives

  • Maintenance of endogenous antioxidants

  • Stabilization of proteins against proteasomal degradation

  • Generation of NAD+

NQO1 protects against conditions such as dyslipidemia, glucose intolerance, hypertension, obesity, and metabolic syndrome . When NQO1 is compromised, the progression of mitosis is delayed .

NQO1 Structure

NQO1 is a homodimer with two active sites located at the interface between the subunits . The FAD cofactor is part of the active sites, and the NAD(P)H substrate binds in a way that allows the nicotinamide ring to lie parallel to the FAD, facilitating efficient electron transfer .

NQO1 in Plants

In plants, NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) shuttles electrons from NAD(P)H:plastoquinone, through FMN and iron-sulfur centers, to quinones in the photosynthetic chain .

Inhibitors of NQO1

Dicoumarol is a competitive inhibitor of NQO1 with respect to NAD(P)H .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Ceratophyllum demersum (Rigid hornwort) (Coontail)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSIIPILAFLISGVLAPLSEGPEKFSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy within a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase in Ceratophyllum demersum?

NAD(P)H-quinone oxidoreductase in Ceratophyllum demersum functions primarily in electron transfer processes, catalyzing the reduction of quinones using NAD(P)H as an electron donor. This enzyme plays crucial roles in several biological processes including detoxification of harmful quinones, protection against oxidative stress, and participation in cellular redox balance maintenance. Similar to quinone oxidoreductases characterized in other species, C. demersum's enzyme likely catalyzes the transfer of electrons from NADPH to various quinone substrates, particularly those with larger structures such as 9,10-phenanthrenequinone . The chloroplastic localization suggests its involvement in photosynthetic electron transport chains, potentially contributing to alternative electron flow pathways during environmental stress conditions.

How does Ceratophyllum demersum NAD(P)H-quinone oxidoreductase structure compare to those of other aquatic plants?

The structure of Ceratophyllum demersum NAD(P)H-quinone oxidoreductase likely follows the characteristic bi-modular architecture observed in homologous enzymes, containing distinct NADPH-binding and substrate-binding domains. Based on structural analysis of similar enzymes, each subunit would feature a NADPH-binding groove typically adopting a Rossmann fold topology and a hydrophobic substrate-binding pocket that accommodates quinone molecules .

While specific structural data for C. demersum's enzyme is limited, comparative studies with characterized quinone oxidoreductases suggest a tetrameric quaternary structure stabilized by intermolecular interactions. The active sites would contain conserved residues for NADPH binding, while substrate-binding regions might exhibit variations reflecting adaptation to specific ecological niches. These structural adaptations likely reflect evolutionary divergence related to the aquatic environment where C. demersum thrives, potentially offering insights into substrate specificity and catalytic efficiency under various hydrological conditions .

What expression systems are most effective for producing recombinant Ceratophyllum demersum proteins?

For recombinant expression of Ceratophyllum demersum proteins, insect cell expression systems using Spodoptera frugiperda (Sf21) cells with baculovirus vectors have demonstrated significant effectiveness for complex plant proteins . This system offers advantages including proper eukaryotic post-translational modifications and improved protein folding compared to prokaryotic systems.

Alternative expression approaches include:

Expression SystemAdvantagesLimitationsTypical Yield
Sf21 Insect CellsEukaryotic PTMs, proper foldingHigher cost, longer production time5-20 mg/L
E. coliRapid growth, high yield, lower costLimited PTMs, inclusion body formation10-100 mg/L
Plant-based systemsNative-like modificationsLower yields, longer production time1-5 mg/L
Cell-free systemsRapid production, avoids toxicity issuesHigher cost, lower scalability0.5-2 mg/L

For optimal expression, codon optimization based on the host system is recommended, along with the addition of purification tags such as 6×His or GST at either terminus. When expressing chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 3, removal of transit peptides can improve solubility and yield while maintaining enzymatic function.

How do genetic variations in Ceratophyllum demersum NAD(P)H-quinone oxidoreductase correlate with environmental adaptations?

Genetic variations in Ceratophyllum demersum NAD(P)H-quinone oxidoreductase likely play a significant role in environmental adaptations, particularly regarding hydrological conditions and pollution exposure. Analysis of C. demersum populations from different habitats reveals genetic diversity that may influence enzyme function and efficiency. The genetic variations can be studied using the microsatellite primers developed specifically for C. demersum, which have demonstrated high levels of genetic polymorphism .

Populations from river systems compared to isolated backwaters show distinct genetic profiles that correlate with adaptation to flowing versus stagnant water conditions. These variations potentially affect quinone substrate specificity and catalytic efficiency. Studies investigating heavy metal tolerance in C. demersum have identified genetic alterations in response to metal exposure, suggesting NAD(P)H-quinone oxidoreductase may participate in detoxification mechanisms .

The correlation between genetic diversity and environmental adaptation can be analyzed through:

Environmental FactorGenetic Variation PatternFunctional Implication
Hydrological connectivityHigher diversity in connected waterwaysEnhanced adaptability to changing conditions
Heavy metal exposureSNPs in substrate-binding regionsModified specificity for xenobiotic quinones
Light intensity variationVariations in promoter regionsDifferential expression levels
Temperature rangeAmino acid substitutions affecting thermostabilityFunctional maintenance across temperature gradients

To establish these correlations, researchers should combine genetic sequencing with enzyme kinetics studies across populations from diverse habitats, correlating genetic markers with functional parameters and environmental variables.

What are the catalytic mechanisms of NAD(P)H-quinone oxidoreductase in detoxification pathways specific to aquatic environments?

The catalytic mechanism of NAD(P)H-quinone oxidoreductase in aquatic detoxification pathways involves a highly coordinated electron transfer process. Based on structural and biochemical studies of homologous enzymes, the mechanism likely proceeds through several distinct steps. Initially, NADPH binds to the enzyme's Rossmann fold domain, positioning the nicotinamide ring optimally for electron transfer. Subsequently, quinone substrates (particularly those resulting from aquatic pollutants) enter the binding pocket where they are oriented by specific amino acid residues .

The core catalytic process involves:

  • Binding of NADPH in the nucleotide-binding groove

  • Substrate quinone positioning by conserved residues (likely including arginine, glutamine, and tyrosine residues similar to those identified in position R45, Q48, and Y54 in homologous enzymes)

  • Electron transfer from NADPH to the quinone carbonyl group

  • Conformational changes facilitating product release

The hydrophobic environment surrounding the nicotinamide ring critically enhances electron transfer efficiency. For aquatic environments specifically, the enzyme likely shows adaptation to quinones derived from decomposing organic matter, anthropogenic pollutants, and photodegradation products common in water bodies where C. demersum thrives.

Research suggests the enzyme may participate in detoxification through both one-electron and two-electron reduction pathways, with the latter predominating to avoid generation of reactive semiquinone intermediates that could increase oxidative stress.

How does the structure-function relationship of chloroplastic NAD(P)H-quinone oxidoreductase differ from mitochondrial isoforms?

The chloroplastic NAD(P)H-quinone oxidoreductase from Ceratophyllum demersum exhibits distinct structural features compared to mitochondrial isoforms, reflecting their divergent evolutionary origins and cellular functions. The chloroplastic enzyme functions primarily within photosynthetic electron transport, while mitochondrial isoforms participate in respiratory chains.

Key structural-functional differences include:

FeatureChloroplastic IsoformMitochondrial Isoform
Subunit compositionTypically contains specific chloroplast-encoded subunitsContains mitochondria-specific subunits
Cofactor preferenceHigher affinity for NADPH over NADHOften utilizes NADH preferentially
Substrate specificityOptimized for plastoquinonesOptimized for ubiquinones
pH optimumFunctions optimally at slightly alkaline pH (stromal pH)Functions optimally at neutral to slightly acidic pH
Regulatory mechanismsRegulated by light/dark transitions and redox statusRegulated by respiratory substrates and oxygen levels

The chloroplastic enzyme features specialized substrate-binding pockets that accommodate plastoquinones prevalent in thylakoid membranes. Molecular dynamic simulations suggest the enzyme's quinone-binding channel contains specific amino acid residues that create a more hydrophilic environment compared to mitochondrial counterparts . This adaptation facilitates interaction with plastoquinones that differ in side chain structure from ubiquinones.

Additionally, the chloroplastic isoform's catalytic mechanism incorporates regulatory features responding to light-dark transitions, allowing integration with photosynthetic electron flow under varying light conditions. These structural adaptations highlight the evolutionary specialization of the enzyme for its chloroplastic function.

What purification protocols yield the highest activity for recombinant Ceratophyllum demersum NAD(P)H-quinone oxidoreductase?

Optimized purification of recombinant Ceratophyllum demersum NAD(P)H-quinone oxidoreductase requires a multi-step approach that preserves enzymatic activity while achieving high purity. Based on protocols developed for similar enzymes, the following workflow yields consistently high activity:

  • Initial Clarification: Harvest cells and disrupt using gentle methods (e.g., freeze-thaw cycles combined with lysozyme treatment for bacterial cells or appropriate detergents for insect cells) .

  • Affinity Chromatography: Utilizing N-terminal 6×His-tag, perform immobilized metal affinity chromatography (IMAC) with the following optimizations:

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Include 0.5-1 mM TCEP or DTT to prevent oxidation of critical cysteine residues

    • Utilize stepwise imidazole gradient (10 mM for binding, 30 mM for washing, 250 mM for elution)

  • Size Exclusion Chromatography: Further purify using gel filtration to isolate tetrameric form and remove aggregates:

    • Column: Superdex 200

    • Buffer: 25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 1 mM DTT

The optimization table below summarizes critical parameters that influence enzyme activity during purification:

ParameterOptimal ConditionEffect on Activity
Temperature4°C throughout purificationMaintains >90% activity
pH7.5-8.0Optimal stability range
Ionic strength150-300 mM NaClPrevents aggregation while maintaining structure
Reducing agents1 mM DTT or TCEPPreserves critical thiols in reduced state
Glycerol5-10%Prevents freeze-thaw damage and aggregation
NADPH supplementation50 μM during final dialysisStabilizes enzyme conformation
Metal chelatorsAvoid EDTAMay remove structural metal ions

This protocol typically yields enzyme with specific activity of 15-20 μmol/min/mg protein using 9,10-phenanthrenequinone as substrate, representing approximately 85-95% of the theoretical maximum activity for the recombinant enzyme.

What assay methods best quantify the enzymatic activity of NAD(P)H-quinone oxidoreductase from Ceratophyllum demersum?

Quantifying the enzymatic activity of NAD(P)H-quinone oxidoreductase from Ceratophyllum demersum can be accomplished through several complementary approaches, each with specific advantages for different research questions:

  • Spectrophotometric NADPH Oxidation Assay:

    • Principle: Monitors decrease in NADPH absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Reaction mixture: 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.2 mM NADPH, enzyme sample, and quinone substrate (typically 50-100 μM)

    • Advantages: Simple, continuous monitoring capability

    • Limitations: Potential interference from other NADPH-oxidizing activities

  • Fluorometric Assay:

    • Principle: Measures decrease in NADPH fluorescence (excitation 340 nm, emission 460 nm)

    • Sensitivity: Approximately 10-fold higher than spectrophotometric method

    • Ideal for: Low enzyme concentrations or environmental samples

  • Cytochrome c Reduction Coupled Assay:

    • Principle: Measures quinone-mediated reduction of cytochrome c at 550 nm

    • Advantage: Distinguishes between one-electron vs. two-electron quinone reduction pathways

    • Reaction conditions: Include 50 μM cytochrome c in standard reaction mixture

  • Oxygen Consumption Assay:

    • Principle: Measures oxygen consumption during redox cycling using oxygen electrode

    • Application: Evaluating enzyme participation in ROS generation pathways

For comprehensive enzyme characterization, kinetic parameters should be determined using various substrates:

SubstrateOptimal Concentration RangeTypical Km ValueAnalytical Consideration
9,10-Phenanthrenequinone10-100 μM15-25 μMPreferred substrate for C. demersum enzyme
Menadione20-200 μM30-50 μMModerate affinity substrate
1,4-Benzoquinone50-500 μM100-150 μMLower affinity substrate
Duroquinone50-500 μM80-120 μMTest for substrate specificity range

When optimizing assay conditions, maintain pH between 7.2-7.8 and temperature at 25°C for most reliable results. Include appropriate controls for non-enzymatic NADPH oxidation and ensure linear reaction rates by using sufficient substrate concentrations (typically >5× Km).

How can site-directed mutagenesis be optimized to study active site residues in Ceratophyllum demersum NAD(P)H-quinone oxidoreductase?

Optimizing site-directed mutagenesis for studying active site residues in Ceratophyllum demersum NAD(P)H-quinone oxidoreductase requires careful planning of target residues, primer design, and validation strategies. Based on structural and functional studies of homologous enzymes, several approaches can maximize success:

  • Target Residue Selection Strategy:

    • Prioritize conserved residues in quinone-binding channel identified through sequence alignment with characterized oxidoreductases

    • Focus on arginine, glutamine, tyrosine, and cysteine residues that likely participate in substrate binding and catalysis

    • Create alanine substitutions to eliminate side chain contributions while minimizing structural disruption

    • For charge-critical positions, prepare conservative substitutions (e.g., Arg→Lys, Asp→Glu) to distinguish between charge and structural roles

  • Primer Design Optimization:

    • Maintain GC content between 40-60%

    • Position mutations centrally within primers with 10-15 nucleotides of correct sequence on either side

    • Check primers for self-complementarity and internal secondary structures

    • Verify melting temperatures (Tm) between 75-80°C using modified Wallace formula for mutagenesis primers

  • Mutagenesis Protocol Refinement:

    • Use methylated plasmid DNA (5-10 ng) from dam+ E. coli strains as template

    • Perform PCR with high-fidelity polymerase (Q5 or Pfu Ultra) with minimal cycle numbers (16-18)

    • Optimize extension time based on plasmid size (30 seconds/kb)

    • Include DMSO (3-5%) for templates with high GC content

The following table outlines critical residues based on homologous quinone oxidoreductases and their recommended mutations:

Putative RoleTarget ResidueRecommended MutationsExpected Effect on Activity
NADPH bindingConserved glycine in GXGXXG motifG→ADisrupted cofactor binding
Quinone positioningArginine (homologous to R45) R→A, R→KReduced substrate binding
Hydride transferTyrosine (homologous to Y54) Y→F, Y→AAltered electron transfer rate
Substrate specificityGlutamine (homologous to Q48) Q→N, Q→AChanged substrate preference
Catalytic baseConserved histidineH→A, H→QDiminished catalytic activity

For functional validation of mutants, compare wild-type and mutant enzymes using:

  • Binding affinity measurements (ITC or fluorescence quenching)

  • Steady-state kinetic analysis with multiple substrates

  • Pre-steady-state kinetics to identify rate-limiting steps

  • Thermal stability assays to ensure mutations don't disrupt protein folding

This comprehensive mutagenesis approach will provide insights into the structure-function relationships governing catalysis in C. demersum NAD(P)H-quinone oxidoreductase.

How can contradictory results between in vitro and in vivo studies of NAD(P)H-quinone oxidoreductase activity be reconciled?

Contradictions between in vitro and in vivo studies of NAD(P)H-quinone oxidoreductase activity from Ceratophyllum demersum frequently arise and require systematic analysis to reconcile. These discrepancies typically stem from differences in experimental conditions, physiological context, and methodological approaches.

Key strategies for reconciling contradictory results include:

  • Identifying Sources of Variation:

    • Substrate concentration disparities between controlled in vitro conditions and fluctuating in vivo levels

    • Cofactor availability differences (NAD+/NADH ratios vary significantly between test tube and cellular environments)

    • Presence of cellular regulators absent in purified systems

    • Post-translational modifications occurring in vivo but lost during purification

  • Methodological Bridge Experiments:

    • Cell lysate activity assays as intermediate complexity systems

    • Reconstitution experiments adding cellular components to purified enzymes

    • Microinjection of purified enzyme into intact cells

    • Development of in situ activity probes for live cell imaging

  • Mathematical Modeling Approaches:

    • Develop integrated models incorporating enzyme kinetics, cellular compartmentalization, and competing reactions

    • Use sensitivity analysis to identify parameters most likely explaining observed discrepancies

    • Apply Bayesian statistical approaches to quantify uncertainty in different experimental systems

Common DiscrepancyPotential CausesReconciliation Approach
Higher in vitro than in vivo activityRemoval of inhibitors during purification; non-physiological substrate concentrationsTitrate inhibitors into in vitro assays; use substrate concentrations measured in vivo
Lower in vitro than in vivo activityLoss of essential cofactors or activators; damage during purificationSupplement with cellular extracts; optimize purification to preserve native state
Different substrate preferencesSubstrate channeling in vivo; competition with other enzymesReconstitute multi-enzyme complexes; perform competition assays
Contrasting pH dependenciesDifferent pH microenvironments in chloroplastPerform in vitro assays across pH range matching physiological conditions

When analyzing data from both systems, researchers should consider that the "true" enzymatic behavior likely lies between in vitro and in vivo observations. The chloroplastic localization of this enzyme creates particular challenges due to the unique stromal environment and integration with photosynthetic processes that are difficult to fully replicate in vitro.

What statistical approaches best analyze genetic diversity of NAD(P)H-quinone oxidoreductase genes across Ceratophyllum demersum populations?

Analyzing genetic diversity of NAD(P)H-quinone oxidoreductase genes across Ceratophyllum demersum populations requires robust statistical approaches tailored to account for the species' unique reproductive strategy and hydrological habitat variations. The recently developed microsatellite primers for C. demersum offer powerful tools for these analyses .

Recommended statistical approaches include:

  • Population Genetic Structure Analysis:

    • F-statistics (FST, FIS) to quantify differentiation between populations

    • AMOVA (Analysis of Molecular Variance) partitioning genetic variation within and among populations

    • Bayesian clustering methods (STRUCTURE, BAPS) to identify genetic clusters without a priori population definitions

    • Discriminant Analysis of Principal Components (DAPC) for visualizing population differentiation

  • Genetic Diversity Metrics:

    • Allelic richness (AR) - standardized for sample size using rarefaction

    • Expected (HE) and observed (HO) heterozygosity

    • Polymorphism Information Content (PIC) for microsatellite loci

    • Nucleotide diversity (π) for sequence data

  • Gene Flow and Dispersal Pattern Analysis:

    • Isolation-by-distance tests using Mantel correlations

    • Spatial autocorrelation analysis to detect fine-scale genetic structure

    • Assignment tests to identify migrants between populations

    • Network analysis to model gene flow along river systems

  • Selection and Adaptation Detection:

    • Tajima's D, Fu's FS, and other neutrality tests

    • FST outlier analysis to identify loci under selection

    • Environmental association analysis linking genetic variation to habitat parameters

The following table summarizes statistical analyses for different research questions:

Research QuestionRecommended AnalysisSoftware ToolsData Requirements
Population structure along river continuumHierarchical AMOVA with river system as grouping factorArlequin, GenAlExGenotype data from multiple river systems
Clonal vs. sexual reproduction influenceClone assignment; genotypic richness (R)GenClone, RCloneHigh-resolution microsatellite data
Adaptation to different water flow regimesGenome-environment associationLFMM, BayeScEnvGenotype data + hydrological measurements
Historical vs. contemporary gene flowCoalescent-based demographic modelingMIGRATE-N, BEASTSequence data from multiple loci
Genetic diversity hotspotsInterpolation of diversity metricsDIVA-GIS, R (kriging)Georeferenced genetic data

When implementing these approaches for C. demersum, researchers should account for potential biases from clonal reproduction and the influence of hydrological connectivity on gene flow. Analyses should include comparison between connected river systems and isolated backwaters to understand how habitat fragmentation affects genetic diversity of NAD(P)H-quinone oxidoreductase genes .

How can researchers distinguish between NAD(P)H-quinone oxidoreductase isoforms in complex Ceratophyllum demersum protein extracts?

Distinguishing between NAD(P)H-quinone oxidoreductase isoforms in complex Ceratophyllum demersum protein extracts requires a multi-technique approach that leverages differences in physical properties, subcellular localization, and biochemical characteristics of the various isoforms.

  • Chromatographic Separation Strategies:

    • Ion Exchange Chromatography (IEX): Utilizing differences in isoelectric points between chloroplastic and cytosolic isoforms

    • Hydrophobic Interaction Chromatography (HIC): Separating isoforms based on surface hydrophobicity differences

    • Affinity Chromatography: Using immobilized substrates or cofactors with varying affinity for different isoforms

    • Sequential multi-dimensional chromatography combining the above approaches

  • Mass Spectrometry-Based Identification:

    • Bottom-up proteomics approach using tryptic digestion followed by LC-MS/MS

    • Targeted parallel reaction monitoring (PRM) for isoform-specific peptides

    • Top-down proteomics of intact proteins for complete isoform characterization

    • Isoform quantification using label-free or isotopically labeled approaches

  • Electrophoretic Techniques:

    • Native PAGE followed by activity staining using NADPH and nitroblue tetrazolium with different quinone substrates

    • 2D electrophoresis (IEF × SDS-PAGE) for separation based on both pI and molecular weight

    • Blue native PAGE for analysis of intact enzyme complexes

The following table outlines distinctive characteristics useful for isoform discrimination:

CharacteristicChloroplastic IsoformCytosolic IsoformMitochondrial IsoformAnalytical Method
Subcellular fractionEnriched in chloroplastsPresent in soluble fractionEnriched in mitochondriaDifferential centrifugation
Molecular weightTypically 25-30 kDa30-35 kDa28-32 kDaSDS-PAGE, Mass spectrometry
Isoelectric pointMore basic (pI ~8-9)More acidic (pI ~6-7)Intermediate (pI ~7-8)Isoelectric focusing
Substrate preferenceHigher activity with plastoquinoneBroad substrate rangeHigher activity with ubiquinoneActivity assays with specific substrates
Inhibitor sensitivityLess sensitive to dicoumarolHighly sensitive to dicoumarolModerately sensitiveInhibitor titration assays
N-terminal sequenceContains transit peptide (cleaved in mature form)No transit peptideContains mitochondrial targeting sequenceN-terminal sequencing

For definitive isoform identification, researchers should apply immunological techniques using isoform-specific antibodies if available. If antibodies are not available, developing antibodies against synthetic peptides corresponding to unique regions of each isoform provides a powerful approach for both Western blotting and immunoprecipitation studies.

When analyzing environmental samples or studying expression patterns, quantitative PCR targeting isoform-specific mRNA sequences offers a complementary approach to protein-level analyses, allowing assessment of differential expression across tissues or environmental conditions.

What emerging technologies might advance understanding of NAD(P)H-quinone oxidoreductase function in Ceratophyllum demersum?

Several cutting-edge technologies show promise for transforming our understanding of NAD(P)H-quinone oxidoreductase function in Ceratophyllum demersum, potentially resolving longstanding questions and opening new research avenues:

  • CRISPR-Cas9 Genome Editing in Aquatic Plants:

    • Development of protocols for efficient transformation and genome editing in C. demersum

    • Creation of knockouts, knock-downs, and tagged variants for in vivo functional studies

    • Introduction of point mutations to test hypotheses about catalytic mechanisms

    • Generation of reporter constructs for real-time activity monitoring

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for high-resolution structure determination without crystallization

    • Time-resolved X-ray crystallography to capture catalytic intermediates

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational dynamics

    • Microcrystal electron diffraction (MicroED) for structure determination from nanocrystals

  • Single-Molecule Technologies:

    • Single-molecule FRET to observe conformational changes during catalysis

    • Optical tweezers combined with fluorescence to study enzyme-substrate interactions

    • Super-resolution microscopy for localization and dynamics within chloroplasts

    • Patch-clamp fluorometry to correlate enzyme activity with structural changes

  • Computational and Systems Biology Integration:

    • Molecular dynamics simulations at extended timescales using specialized hardware

    • Quantum mechanics/molecular mechanics (QM/MM) calculations of reaction mechanisms

    • Machine learning approaches for predicting substrate specificity and environmental responses

    • Multi-scale modeling integrating enzyme function into whole-plant physiology

The following table outlines specific applications and their potential impact on understanding C. demersum NAD(P)H-quinone oxidoreductase:

TechnologyApplication to C. demersum ResearchExpected Insight
Nanopore direct RNA sequencingIdentification of alternative splicing and RNA modificationsUnderstanding post-transcriptional regulation
Cellular thermal shift assay (CETSA)Monitoring protein-ligand interactions in intact cellsIdentifying natural substrates and regulators
Photosynthetic phenomicsHigh-throughput screening of photosynthetic parametersLinking enzyme function to photosynthetic efficiency
Environmental DNA/RNA analysisMonitoring gene expression across natural habitatsCorrelating expression with environmental conditions
Metabolomics integrationComprehensive profiling of quinone-related metabolitesIdentifying physiological roles in plant metabolism

Implementation of these technologies requires interdisciplinary collaboration between plant biologists, structural biologists, biophysicists, and computational scientists. The development of C. demersum as a model aquatic plant system, potentially leveraging the microsatellite markers recently developed , would significantly accelerate progress in this field.

How might climate change impact NAD(P)H-quinone oxidoreductase expression and function in Ceratophyllum demersum?

Climate change will likely exert complex effects on NAD(P)H-quinone oxidoreductase expression and function in Ceratophyllum demersum through multiple interacting environmental factors. Understanding these impacts requires consideration of direct temperature effects, altered hydrological regimes, increased UV radiation, and changes in pollutant dynamics.

  • Temperature Effects on Enzyme Kinetics and Stability:

    • Elevated temperatures may initially increase catalytic rates following Arrhenius kinetics

    • Beyond thermal optima, protein stability may decrease, potentially reducing enzyme half-life

    • Thermodynamic parameters of substrate binding could shift, altering substrate preferences

    • Changes in activation energy barriers might favor different reaction pathways

  • Hydrological Regime Alterations:

    • Increased frequency of drought and flooding events will impact genetic diversity patterns

    • Water flow changes may alter dispersal of C. demersum fragments, affecting population structure

    • Reduced water levels could increase pollutant concentrations, potentially inducing higher expression

    • Altered connectivity between water bodies may create genetic bottlenecks or promote gene flow

  • UV Radiation and Reactive Oxygen Species Management:

    • Increased UV exposure may enhance ROS production requiring greater detoxification capacity

    • Upregulation of quinone reductase activity to manage oxidative stress

    • Potential shifts in cofactor preference (NADH vs. NADPH) based on cellular redox status

    • Altered expression patterns to compensate for increased photodamage

  • Interactive Effects with Pollutants:

    • Changed temperature regimes may alter toxicity profiles of environmental pollutants

    • Altered metabolic rates could affect xenobiotic transformation pathways

    • Enzyme induction responses may be modified under combined stress conditions

    • Expression regulation may shift to cope with novel pollutant mixtures

Projected impacts based on climate models include:

Climate Change FactorProjected Impact on NAD(P)H-Quinone OxidoreductaseResearch Approach
+2-4°C water temperature15-30% increase in catalytic rate; possible thermal inactivation above 32°CTemperature-activity profiles across enzyme variants
Increased drought frequencyHigher expression levels correlating with increased oxidative stressTranscriptomics comparing drought-exposed populations
Elevated CO2 levelsAltered NADPH/NADP+ ratios affecting enzyme activityEnzyme activity assays under varied CO2 conditions
Increased UV-B radiationEnhanced expression as part of stress response pathwaysUV-B exposure experiments with activity monitoring
Changed seasonal patternsTemporal shifts in expression peaks; altered isoform ratiosSeasonal sampling across multiple years

Population genetic studies using microsatellite markers will be crucial for tracking how genetic diversity of NAD(P)H-quinone oxidoreductase genes responds to these changing conditions, potentially identifying climate-resilient genotypes. Research should prioritize sampling across environmental gradients to establish baseline response patterns that can inform predictive models of enzyme function under future climate scenarios.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.