Recombinant Ceratophyllum demersum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

This subunit is integral to the NADH dehydrogenase (NDH) complex, which shuttles electrons from NAD(P)H to plastoquinone in chloroplasts. Key roles include:

  • Electron Transport: Facilitates the transfer of electrons to the photosynthetic electron transport chain, contributing to ATP synthesis via proton translocation .

  • Proton Gradient Maintenance: Couples redox reactions to proton pumping, conserving energy for ATP production .

  • Stress Response: While not directly studied in C. demersum, homologous enzymes in other plants (e.g., Arabidopsis) detoxify reactive electrophiles like γ-ketols, suggesting potential roles in oxidative stress mitigation .

Production and Handling

The recombinant protein is produced via bacterial expression and purified using affinity chromatography. Critical handling guidelines include:

ParameterDetails
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionSterile deionized water (0.1–1.0 mg/mL); add 5–50% glycerol for stability
Storage Conditions-20°C/-80°C (long-term); avoid repeated freeze-thaw cycles

Research Applications

This protein is valuable for studying:

  1. Chloroplast Electron Transport: Investigating NDH complex interactions and proton translocation mechanisms .

  2. Protein-Protein Interactions: Mapping subunit assembly within the NDH complex.

  3. Stress Biology: Exploring detoxification pathways in plants under oxidative stress, informed by homologous enzymes in other species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Please reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Ceratophyllum demersum (Rigid hornwort) (Coontail)
Target Names
ndhE
Target Protein Sequence
MMLEHELVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGPAIVSSIYRNRRSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, thereby conserving redox energy within a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase subunit 4L in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 4L (NDH-4L) in chloroplasts is a crucial component of the chloroplastic NDH complex, which participates in cyclic electron flow around Photosystem I (PSI). This complex oxidizes NADPH and reduces plastoquinone, playing a significant role in photoprotection and optimizing photosynthesis under varying environmental conditions.

The NDH complex in chloroplasts is structurally similar to respiratory complex I but has evolved to function specifically in chloroplastic electron transport. In Ceratophyllum demersum, an aquatic macrophyte, the NDH complex may have adapted specifically for underwater photosynthesis, where light conditions and carbon availability differ significantly from terrestrial environments.

What are the recommended expression systems for producing recombinant NDH-4L protein?

The expression of chloroplastic proteins can be challenging due to their membrane-associated nature and specific folding requirements. Based on current methodologies for similar proteins, the following systems are recommended:

Expression SystemAdvantagesLimitationsYield Potential
E. coli BL21(DE3)Fast growth, simple media requirementsMay form inclusion bodies requiring refoldingLow to moderate
Insect cell systemsBetter post-translational modificationsLonger production time, more expensiveModerate
Plant-based expressionNative-like folding and modificationsTime-consuming, lower yieldLow
Cell-free expressionAvoids toxicity issues, fasterExpensive, scale limitationsLow

For optimal results, vector design should include a cleavable affinity tag (e.g., His6, GST) to facilitate purification while allowing removal for functional studies. Codon optimization for the expression host is essential, particularly for the E. coli system, as chloroplastic genes often have different codon usage patterns.

How can I assess the purity and integrity of isolated recombinant NDH-4L?

Multiple complementary techniques should be employed:

  • SDS-PAGE: Use 12-15% gels to visualize protein bands, expecting NDH-4L to appear around 15-20 kDa.

  • Western blotting: If available, use antibodies against conserved NDH complex epitopes. Alternatively, antibodies against the affinity tag can be used.

  • Mass spectrometry: For definitive identification and to verify post-translational modifications.

  • Size exclusion chromatography: To assess aggregation state and complex formation.

  • Circular dichroism: To evaluate secondary structure integrity.

A typical quality control workflow should include at least SDS-PAGE, Western blotting, and either mass spectrometry or N-terminal sequencing to confirm protein identity before proceeding to functional assays.

What are the optimal conditions for assessing NDH-4L enzymatic activity?

NDH complex activity is typically assessed by monitoring the oxidation of NAD(P)H and/or the reduction of quinone analogs. For recombinant NDH-4L from Ceratophyllum demersum, consider the following parameters:

ParameterRecommended RangeConsiderations
pH7.0-8.0Buffer system should match native chloroplastic pH
Temperature25-30°CMatch the natural habitat temperature of C. demersum
SubstrateNADPH (0.1-0.5 mM)NADH can also be tested for specificity comparison
Electron acceptorDecylubiquinone (50-100 μM)Alternative: 2,6-dichlorophenolindophenol (DCPIP)
Assay additives1-5 mM MgCl₂, 0.1-0.5 mM EDTATo stabilize protein structure

The activity assay should be performed spectrophotometrically by monitoring either NADPH oxidation (decrease in absorbance at 340 nm) or reduction of DCPIP (decrease in absorbance at 600 nm).

When interpreting results, it's important to note that the isolated subunit may show different kinetic properties compared to the intact NDH complex. Comparing activity across different preparation methods and in the presence of other subunits can provide valuable insights into subunit cooperativity.

How does the structure-function relationship of NDH-4L compare to other NDH subunits like NdhH?

While NdhH is a larger subunit (~45-49 kDa) that contains conserved regions for cofactor binding , NDH-4L is a smaller membrane-embedded subunit primarily involved in complex assembly and stability.

The structure-function analysis should consider:

  • Transmembrane domain prediction and analysis

  • Conservation of key residues across species

  • Potential interaction sites with other subunits

  • Lipid-binding regions that may be crucial for membrane association

Computational analysis using tools like TMHMM, Phobius, or CCTOP can identify transmembrane segments, while molecular modeling based on homologous proteins can provide structural insights. The hydrophobicity profile of NDH-4L will typically show distinct membrane-spanning regions that are crucial for integration into the thylakoid membrane.

For experimental structure-function studies, site-directed mutagenesis of conserved residues followed by activity assays and complex assembly analysis is recommended. Crosslinking studies with other NDH subunits can also identify critical interaction interfaces.

What are the best approaches for studying the integration of NDH-4L into the complete NDH complex?

Studying the assembly of membrane protein complexes requires specialized techniques:

  • Blue Native PAGE (BN-PAGE): This technique preserves native protein-protein interactions and can be used to visualize different assembly intermediates of the NDH complex.

  • Sucrose Gradient Ultracentrifugation: This method separates protein complexes based on size and can isolate intact NDH complexes for further analysis.

  • Co-immunoprecipitation (Co-IP): Using antibodies against NDH-4L or other subunits to pull down interaction partners and identify them by mass spectrometry.

  • Fluorescence Resonance Energy Transfer (FRET): By tagging NDH-4L and potential interaction partners with fluorescent proteins, their proximity can be assessed in vivo.

  • Cryo-electron microscopy: For structural characterization of the assembled complex.

When performing these experiments, it's crucial to use gentle solubilization conditions with appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin) to maintain complex integrity. Time-course assembly studies can provide insights into the sequential incorporation of subunits during complex formation.

How can redox regulation of the NDH complex be investigated experimentally?

The NDH complex activity can be modulated by redox conditions, similar to glutathione peroxidase systems . To investigate this:

  • Thiol modification experiments: Use thiol-reactive compounds like N-ethylmaleimide (NEM) or iodoacetamide to block cysteine residues and assess their impact on activity.

  • Redox titration: Expose the protein to varying ratios of oxidized/reduced glutathione or DTT and measure activity changes.

  • Hydrogen peroxide sensitivity: Test if NDH-4L is sensitive to oxidative stress, similar to how some peroxidases respond to hydroperoxides .

  • Site-directed mutagenesis: Replace conserved cysteine residues to determine their role in redox sensing.

A typical experimental design would include:

TreatmentConcentration RangeControlExpected Outcome if Redox Sensitive
H₂O₂0.1-1 mMCatalase addedActivity decrease
GSH/GSSG1-10 mM (varying ratios)Buffer onlyActivity change with redox state
DTT1-5 mMOxidized DTTActivity increase if disulfides present
NEM0.1-1 mMNo NEMActivity decrease if thiols essential

Results should be interpreted in the context of the cellular redox environment, considering that chloroplasts undergo significant redox changes during light/dark transitions.

What are common pitfalls in recombinant NDH-4L expression and how can they be addressed?

Several challenges typically arise when expressing membrane proteins like NDH-4L:

  • Low expression levels: Often caused by toxicity to the host cell. Solutions include:

    • Using tightly controlled inducible promoters

    • Lowering induction temperature (16-20°C)

    • Using specialized host strains (e.g., C41/C43 for E. coli)

    • Adding membrane-stabilizing compounds to the growth media

  • Inclusion body formation: Common with membrane proteins expressed in E. coli. Approaches include:

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Optimization of cell lysis and membrane protein extraction methods

  • Protein instability: NDH subunits may be unstable when expressed individually. Consider:

    • Co-expression with interacting subunits

    • Addition of stabilizing ligands during purification

    • Use of specialized detergents (LMNG, GDN) for extraction

  • Improper folding: Verify proper folding using:

    • Limited proteolysis to assess compact structure

    • Fluorescence spectroscopy to examine tertiary structure

    • Activity assays to confirm functionality

Systematic optimization of expression conditions (temperature, inducer concentration, duration) followed by careful monitoring of protein quality at each purification step is essential for success.

How can I design experiments to investigate NDH-4L's role in cyclic electron flow?

To study NDH-4L's role in cyclic electron flow around PSI:

  • In vitro reconstitution: Reconstitute purified NDH-4L with other NDH subunits and measure electron transfer rates from NADPH to plastoquinone analogs.

  • Chlorophyll fluorescence analysis: In plant systems expressing modified NDH-4L (or lacking it), measure parameters like:

    • Post-illumination fluorescence rise (indicator of NDH activity)

    • PSI cyclic electron flow rates

    • Non-photochemical quenching capacity

  • P700 redox kinetics: Measure the re-reduction rate of P700⁺ (the PSI reaction center chlorophyll) after a light pulse, which reflects cyclic electron flow activity.

  • Comparative analysis: Compare wild-type plants with those expressing modified NDH-4L under various light conditions and stresses.

A comprehensive experimental design should include:

MeasurementTechniqueProvides Information About
NADPH oxidationSpectrophotometryDirect NDH activity
Plastoquinone reductionHPLC or fluorescence quenchingElectron acceptor function
P700 redox kineticsAbsorbance changes at 830 nmIntegration with PSI
Proton gradient formation9-aminoacridine fluorescenceBioenergetic outcomes
ATP/NADPH ratioEnzymatic assaysMetabolic consequences

Results should be interpreted in the context of the plant's growth conditions, as the importance of NDH-mediated cyclic electron flow typically increases under stress conditions.

What analytical techniques are most suitable for detecting post-translational modifications on NDH-4L?

Post-translational modifications (PTMs) can significantly affect NDH-4L function. The following techniques are recommended for comprehensive PTM analysis:

  • Mass spectrometry approaches:

    • High-resolution LC-MS/MS after tryptic digestion

    • Electron transfer dissociation (ETD) for preserving labile modifications

    • Multiple reaction monitoring (MRM) for quantitative analysis of specific PTMs

  • Targeted modification analysis:

    • Phosphorylation: Pro-Q Diamond staining, phospho-specific antibodies

    • Oxidative modifications: OxyBlot for carbonylation, dimedone labeling for sulfenic acids

    • Glycosylation: Periodic acid-Schiff staining, lectin blotting

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Activity assays before and after treatment with modification-removing enzymes

    • Structural analysis to assess PTM effects on protein conformation

A systematic workflow should include:

StepTechniqueOutput
IdentificationLC-MS/MSMap of possible modification sites
ValidationSite-specific methods (Western blot, etc.)Confirmation of key modifications
QuantificationTargeted MS or modification-specific assaysStoichiometry of modifications
Functional analysisActivity assays with modified vs. unmodified proteinPhysiological relevance

When analyzing PTMs, consider that their pattern may change depending on the plant's growth conditions, developmental stage, or stress exposure. Comparative analysis across different conditions can reveal regulatory mechanisms.

How can comparative genomics inform our understanding of NDH-4L evolution in aquatic plants?

Comparative genomic approaches provide valuable insights into the evolutionary adaptations of NDH-4L in aquatic plants like Ceratophyllum demersum:

  • Sequence conservation analysis: Compare NDH-4L sequences across terrestrial and aquatic plants to identify:

    • Aquatic plant-specific amino acid substitutions

    • Selection pressure signatures (dN/dS ratios)

    • Lineage-specific insertions or deletions

  • Synteny analysis: Examine the genomic context of NDH-4L to identify:

    • Changes in gene order or orientation

    • Co-evolution with interacting partners

    • Potential horizontal gene transfer events

  • Correlation with ecological adaptations:

    • Compare NDH-4L sequences from plants in different aquatic environments

    • Correlate sequence features with habitat characteristics

    • Analyze convergent evolution in unrelated aquatic lineages

A systematic comparative analysis should include representatives from:

  • Submerged aquatic plants (like Ceratophyllum)

  • Floating aquatic plants

  • Amphibious plants

  • Terrestrial relatives

Evolutionary insights can guide the design of functional studies by highlighting potentially important residues or regions that have undergone adaptive changes in aquatic environments.

What imaging techniques can be used to study NDH complex localization and dynamics in chloroplasts?

Advanced imaging approaches for studying NDH complex distribution and dynamics include:

  • Confocal microscopy with fluorescent protein fusions:

    • NDH-4L tagged with GFP or other fluorescent proteins

    • Co-localization with other thylakoid membrane markers

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

  • Super-resolution microscopy:

    • STED (Stimulated Emission Depletion) microscopy

    • PALM (Photoactivated Localization Microscopy)

    • STORM (Stochastic Optical Reconstruction Microscopy)

    These techniques can resolve NDH complex distribution beyond the diffraction limit, revealing potential microdomains within thylakoid membranes.

  • Electron microscopy approaches:

    • Immunogold labeling of NDH-4L for TEM

    • Correlative light and electron microscopy (CLEM)

    • Cryo-electron tomography for 3D visualization

  • Live-cell imaging:

    • Tracking NDH complex dynamics during light transitions

    • Monitoring response to environmental stresses

    • FRET-based sensors to detect conformational changes

The table below compares these imaging approaches:

TechniqueResolutionLive/FixedAdvantagesLimitations
Confocal~200 nmBothMulti-color, readily availableLimited resolution
STED~30-70 nmBothCompatible with live cellsPhotodamage concerns
PALM/STORM~10-30 nmMainly fixedHighest resolutionComplex sample preparation
Immunogold TEM~1-5 nmFixed onlyDirect protein localizationComplex sample preparation
Cryo-ET~3-5 nmFixed only3D structural contextSpecialized equipment

When designing imaging experiments, consider the trade-offs between resolution, sample preservation, and the ability to observe dynamic processes.

How does the glutathione system interact with NDH complex function in stress responses?

The glutathione system and NDH complex may interact during plant stress responses, similar to other redox-regulated photosynthetic processes. This interaction can be investigated by:

  • Redox proteomics approach:

    • Identify potential glutathionylation sites on NDH-4L

    • Use biotinylated glutathione to pull down glutathionylated proteins

    • Assess changes in glutathionylation pattern under stress conditions

  • Functional studies with glutathione manipulation:

    • Measure NDH activity after treatment with glutathione peroxidase inhibitors

    • Assess NDH complex performance in plants with altered glutathione levels

    • Investigate the effects of glutathione-depleting compounds on NDH-mediated cyclic electron flow

  • ROS-NDH interaction studies:

    • Measure NDH activity in the presence of hydrogen peroxide and other ROS

    • Investigate if the NDH complex contributes to ROS homeostasis

    • Assess how antioxidant systems like glutathione peroxidase protect NDH function

The glutathione system may protect NDH-4L from oxidative damage during stress conditions through mechanisms similar to those observed in other enzymes. Alternatively, glutathionylation could serve as a regulatory mechanism to adjust NDH activity based on cellular redox status.

A comprehensive experimental approach would combine genetic tools (glutathione-deficient mutants, NDH subunit mutants) with biochemical techniques (activity assays under varying redox conditions) and stress physiology experiments.

What are the emerging research frontiers in understanding chloroplastic NDH complex function?

Several cutting-edge research areas are expanding our understanding of chloroplastic NDH complexes:

  • Structural biology advances: Cryo-EM structures of complete chloroplastic NDH complexes are revealing the precise arrangement of subunits, including NDH-4L, and providing insights into mechanism.

  • Single-molecule approaches: These techniques allow observation of electron transfer events and conformational changes in individual NDH complexes.

  • Systems biology integration: Understanding how NDH complex regulation interfaces with broader photosynthetic control networks and whole-plant metabolism.

  • Synthetic biology applications: Engineering optimized NDH complexes to enhance photosynthetic efficiency, particularly under fluctuating light or stress conditions.

  • Ecological and evolutionary perspectives: Comparative studies across diverse plant lineages to understand NDH complex adaptation to different photosynthetic environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.