The recombinant Ceratophyllum demersum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered transmembrane protein derived from the rigid hornwort (Ceratophyllum demersum). This protein is a critical component of the Photosystem II (PSII) core complex in oxygenic photosynthesis, playing a central role in light-driven water oxidation and chlorophyll binding . The recombinant form is produced for research and diagnostic applications, including structural studies, functional assays, and antibody development .
The psbB protein (UniProt ID: A8SEC9) spans 508 amino acids, forming a transmembrane structure with a His-tag for purification . Key structural features include:
Chlorophyll-binding sites: Integral to stabilizing the PSII reaction center and facilitating electron transfer.
Interaction with CP43 and D1/D2 proteins: Critical for forming the PSII core complex .
Amino Acid Sequence Highlights
The sequence begins with MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM... and includes conserved motifs for chlorophyll binding and membrane integration .
psbB (CP47) binds chlorophyll a and stabilizes the PSII reaction center, enabling light-driven water splitting into oxygen, protons, and electrons . It interacts with extrinsic proteins (e.g., PsbO, PsbV) and assembly factors like Psb27 during PSII biogenesis and repair .
The recombinant psbB is expressed in E. coli (common host for plant proteins) and purified via affinity chromatography due to its His-tag . Key specifications include:
| Parameter | Value/Description |
|---|---|
| Expression Host | E. coli |
| Tag | His-tag (N-terminal) |
| Purity | >90% (SDS-PAGE verified) |
| Storage Buffer | Tris-based buffer, 50% glycerol |
| Stability | Stable at -20°C/-80°C; avoid freeze-thaw |
| Reconstitution | Deionized water (0.1–1.0 mg/mL) |
Solubility: Requires reconstitution in aqueous buffers with glycerol for stability .
Reactivity: Used in ELISA kits for detecting anti-psbB antibodies in environmental or plant-based studies .
In studies on Chlorella pyrenoidosa, psbB was down-regulated under 17α-estradiol (17α-EE2) stress, highlighting its sensitivity to environmental pollutants . This aligns with broader observations of PSII-related gene suppression under oxidative stress.
The structural conservation between species underscores psbB’s universal role in PSII but suggests niche adaptations to environmental conditions (e.g., aquatic vs. terrestrial habitats).
ELISA Kits: Used to detect psbB-specific antibodies in plant physiology or environmental monitoring .
Structural Biology: Cryo-EM studies leverage recombinant psbB to model PSII assembly and repair .
CP47 serves as a critical core component of Photosystem II (PSII), which is a light-driven water:plastoquinone oxidoreductase that uses light energy to extract electrons from water molecules, generating oxygen and establishing a proton gradient essential for ATP formation .
Specifically, CP47:
Binds chlorophyll molecules and helps catalyze the primary light-induced photochemical processes of PSII
Serves as an internal antenna complex that captures light energy and transfers it to the reaction center
Provides structural stability to the PSII complex
Functions as a binding platform for assembly factors during PSII biogenesis
Research has revealed that the C-terminal region of CP47 plays a crucial role in the directionality of PSII assembly. In mature PSII complexes (PSII-M), the CP47 C-terminus interacts with the D1 D-E loop, which prevents binding of the assembly factor Psb28 and thus inhibits the reverse assembly process .
The assembly of Photosystem II is a sequential, highly coordinated process with CP47 playing a central role in multiple protein-protein interactions:
During early assembly stages, CP47 binds to the minimal reaction center complex (RC) to form the RC47a intermediate complex
The C-terminus of CP47 interacts with the D1 D-E loop, forming a structural element that influences assembly directionality
CP47 serves as a binding platform for multiple assembly factors:
Structural studies have shown that the binding of Psb28 to CP47 induces the formation of an extended β-hairpin structure that incorporates the central antiparallel β-sheet of Psb28, the C-terminus of CP47, and the D1 D-E loop. This interaction is specific to assembly intermediates and is prevented in mature PSII by conformational changes in the CP47 C-terminus .
Advanced studies of CP47-assembly factor interactions require careful experimental design to capture these often transient interactions. Based on current research approaches:
Nuclear Magnetic Resonance (NMR) Spectroscopy Method:
Prepare recombinant Psb28 protein expressed in a cell-free system
Synthesize peptides representing the conserved CP47 C-terminus
Perform chemical shift perturbation (CSP) experiments to characterize the interaction in detail
Determine the dissociation constant (Kd) to quantify binding affinity
Chemical Cross-linking with Mass Spectrometry:
Isolate PSII assembly intermediates from Ceratophyllum demersum or model organisms
Apply chemical cross-linking agents to stabilize protein-protein interactions
Digest the cross-linked proteins with proteases
Analyze the resulting peptides using mass spectrometry
When analyzing binding interactions, researchers should maintain physiologically relevant conditions (pH 6.5-7.5, temperature 20-25°C) and consider using detergents compatible with membrane protein studies (e.g., n-dodecyl β-D-maltoside or digitonin) to maintain protein stability while preserving native interactions .
Isolating and purifying transmembrane proteins like CP47 presents significant challenges due to their hydrophobic nature. A methodological approach includes:
Expression System Selection:
Cell-free expression systems have proven effective for recombinant CP47 production, avoiding complications associated with membrane insertion and protein folding in traditional cell-based systems
Purification Protocol:
Solubilize the recombinant protein using mild detergents that preserve protein structure (e.g., n-dodecyl β-D-maltoside)
Apply affinity chromatography utilizing tags incorporated during expression
Implement size exclusion chromatography to separate monomeric protein from aggregates
Confirm protein integrity using circular dichroism spectroscopy and fluorescence measurements
Storage Conditions:
Store in Tris-based buffer with 50% glycerol optimized for protein stability
Maintain at -20°C for long-term storage, or -80°C for extended preservation
Avoid repeated freeze-thaw cycles by preparing working aliquots stored at 4°C for up to one week
Research has demonstrated that small volumes of the protein may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap .
Studying structural dynamics of CP47 during PSII assembly and repair requires specialized techniques:
Cryo-Electron Microscopy (Cryo-EM):
Isolate PSII assembly intermediates at different stages
Prepare samples by rapid freezing in liquid ethane
Collect high-resolution image data using a transmission electron microscope
Process images to generate 3D structures
Compare structures to identify conformational changes in CP47
Two-dimensional Blue Native/SDS-PAGE Analysis:
Isolate thylakoid membranes from Ceratophyllum demersum
Solubilize membranes with mild detergents
Separate protein complexes using blue native PAGE in the first dimension
Perform SDS-PAGE in the second dimension
Identify proteins by immunoblotting or mass spectrometry
Track CP47 association with different assembly intermediates
Radioactive Pulse-Chase Experiments:
Pulse-label newly synthesized proteins with radioactive amino acids
Chase with non-radioactive amino acids
Isolate PSII complexes at different time points
Analyze the incorporation of labeled CP47 into assembly intermediates
These combined approaches have been instrumental in revealing the sequential assembly of PSII complexes and the dynamic role of CP47 in this process .
The interaction between CP47 and Psb28 plays a crucial protective role during PSII assembly:
Mechanism of Photodamage Prevention:
Psb28 binds to the cytosolic side of CP47, close to cytochrome b559 and the QB binding site
This binding effectively blocks electron transport to the acceptor side of PSII
By preventing premature electron flow, Psb28 shields the RC47 complex from excess photodamage during assembly
This protective mechanism is particularly important because partially assembled PSII complexes lack full photoprotection capabilities
The hypothesis of Psb28's protective role is strengthened by observations that Psb28 is also associated with PSII repair complexes, suggesting a similar function during the repair of photodamaged PSII .
Structural Basis for Protection:
Psb28 binding induces the formation of an extended β-hairpin structure incorporating:
The central antiparallel β-sheet of Psb28
The C-terminus of CP47
The D1 D-E loop
This structural arrangement effectively blocks access to the electron transport chain, preventing premature activation of the complex .
Analyzing chlorophyll-binding properties of recombinant CP47 requires specialized spectroscopic techniques:
Absorption Spectroscopy:
Prepare purified recombinant CP47 protein in an appropriate buffer
Record absorption spectra between 350-750 nm
Identify characteristic chlorophyll absorption peaks (approximately 436 nm and 663 nm for chlorophyll a)
Calculate chlorophyll:protein ratios based on extinction coefficients
Circular Dichroism (CD) Spectroscopy:
Scan both far-UV (190-250 nm) and visible (350-750 nm) regions
Far-UV spectra provide information on protein secondary structure
Visible region CD spectra reveal information about pigment-protein interactions and the organization of chlorophylls
Fluorescence Spectroscopy:
Measure fluorescence emission spectra upon excitation at chlorophyll absorption maxima
Analyze fluorescence lifetime using time-resolved fluorescence spectroscopy
Perform fluorescence quenching experiments to study energy transfer dynamics
Resonance Raman Spectroscopy:
Excite samples at wavelengths corresponding to chlorophyll absorption
Analyze vibrational modes associated with chlorophyll-protein interactions
Compare spectra with native PSII complexes to assess functional binding
These techniques, when used in combination, provide comprehensive insight into the chlorophyll-binding properties and functional integrity of recombinant CP47 protein.
Comparative analysis of CP47 sequences across photosynthetic organisms reveals patterns of conservation reflecting the protein's critical role in photosynthesis:
Sequence Conservation Analysis:
| Organism Type | Sequence Identity with C. demersum CP47 | Highly Conserved Regions |
|---|---|---|
| Higher plants | 90-98% | Chlorophyll-binding sites, D1 interaction domains |
| Green algae | 80-90% | Transmembrane helices, cofactor coordination sites |
| Cyanobacteria | 70-85% | Core structural elements, energy transfer pathways |
| Diatoms | 65-75% | Transmembrane domains, selected binding sites |
The high degree of conservation, particularly in transmembrane regions and cofactor-binding sites, underscores the fundamental importance of CP47 structure for PSII function across diverse photosynthetic lineages.
Functionally Significant Variations:
N-terminal and C-terminal regions show higher variability, reflecting adaptation to different membrane environments
Loop regions connecting transmembrane helices display organism-specific variations that may relate to interactions with lineage-specific assembly factors
Certain chlorophyll-binding residues show subtle variations that may fine-tune light-harvesting properties for different ecological niches
These comparative analyses provide valuable insights for researchers studying the evolution of photosynthetic systems and can guide mutagenesis studies targeting specific functional domains.
Recent research has revealed promising anticancer properties of Ceratophyllum demersum extracts, opening new research directions:
Anticancer Properties:
Ethanolic extracts of C. demersum have demonstrated significant anticancer activity, particularly against gastrointestinal tract cancer cells. Flow cytometry analysis of treated cells showed an increased percentage of late apoptotic and necrotic cells, indicating potential therapeutic applications .
Phytochemical Composition:
LC-MS analysis of C. demersum ethanolic extract revealed high content of phenolic compounds (18.50 mg/g), with flavonoids comprising the majority (16.09 mg/g). Newly identified compounds in this plant include:
Connection to Photosynthetic Proteins:
While direct links between CP47 and anticancer activity remain unexplored, research suggests potential connections:
Stress responses in photosynthetic machinery may trigger production of secondary metabolites with bioactive properties
Proteins like CP47 may contain bioactive peptide sequences that could be released during extract preparation
Understanding how environmental conditions affect both photosynthetic protein expression and secondary metabolite production could optimize harvesting for pharmaceutical applications
Safety Profile:
Fish embryo toxicity (FET) tests showed that C. demersum extract is safe for Danio rerio fish up to concentrations of 225 μg/ml, suggesting potential environmental compatibility for large-scale cultivation .
These findings position C. demersum as a promising source of anticancer compounds with chemopreventive potential, warranting further investigation into the relationship between photosynthetic function and bioactive compound production .
Advanced structural biology approaches offer powerful tools for elucidating PSII assembly mechanisms:
Time-Resolved Cryo-Electron Microscopy:
Capture assembly intermediates at millisecond to second timescales
Generate structural movies of assembly processes
Visualize conformational changes in CP47 during complex formation
Identify transient interaction interfaces with assembly factors
Integrative Structural Biology Approach:
| Technique | Application to CP47 Research | Key Insights |
|---|---|---|
| Single-particle cryo-EM | High-resolution structure determination of assembly intermediates | Binding sites of assembly factors, conformational changes during assembly |
| Cross-linking mass spectrometry | Mapping protein-protein interaction networks | Identification of assembly factor binding sites on CP47 |
| Hydrogen-deuterium exchange mass spectrometry | Probing dynamic regions of CP47 | Flexibility changes during assembly, solvent-accessible regions |
| Molecular dynamics simulations | Modeling conformational dynamics | Energy landscapes of structural transitions, effect of mutations |
The recent identification of the single transmembrane helix protein Psb34 bound to a PSII assembly intermediate represents an important advance achieved through these approaches. This protein was previously overlooked due to its hydrophobicity and small size but has now been confirmed to interact with CP47 and play a specific role in the attachment of CP43 to RC47 .
Investigating the directionality of PSII assembly presents several methodological challenges:
Key Challenges and Solutions:
Capturing transient assembly intermediates:
Challenge: Assembly intermediates are often present in low abundance and exist transiently
Solution: Employ synchronization techniques like controlled light/dark transitions combined with rapid isolation methods to enrich specific intermediates
Distinguishing assembly from repair processes:
Recreating membrane environments:
Challenge: Membrane protein interactions depend on lipid environments difficult to preserve in vitro
Solution: Utilize nanodiscs or liposomes with defined lipid compositions to mimic native thylakoid membrane environments
Monitoring directional assembly in real-time:
Challenge: Traditional structural methods provide static snapshots rather than dynamic processes
Solution: Implement single-molecule FRET (Förster Resonance Energy Transfer) to track protein-protein interactions during assembly
Understanding the role of CP47 C-terminus:
Challenge: The C-terminus of CP47 blocks the Psb28 binding site in mature PSII (PSII-M) by interacting with the D1 D-E loop, preventing reverse assembly, but the molecular mechanism is unclear
Solution: Develop site-specific crosslinking methods targeting the CP47 C-terminus to capture its dynamic interactions during assembly progression
Recent advances in nuclear magnetic resonance (NMR) spectroscopy, particularly chemical shift perturbation (CSP) experiments with recombinant Psb28 and synthetic peptides of the conserved CP47 C-terminus, have begun to address these challenges by characterizing these interactions in detail and determining dissociation constants .
Robust experimental design for CP47 functional studies requires careful consideration of controls:
Essential Experimental Controls:
Negative controls:
CP47-depleted PSII preparations to establish baseline assembly efficiency
Heat-denatured recombinant CP47 to confirm structure-dependent functions
Non-binding mutants of assembly factors to validate interaction specificity
Positive controls:
Native CP47 isolated from Ceratophyllum demersum thylakoids
Well-characterized model organism CP47 (e.g., from Synechocystis sp. PCC 6803)
Reconstituted PSII complexes with established assembly properties
Specificity controls:
Competitive binding assays with CP47 peptide fragments
Cross-validation with multiple assembly factors
Comparison across different photosynthetic organisms
Quantitative controls:
Standardized protein concentration determinations
Calibrated spectroscopic measurements
Internal standards for mass spectrometry
A particularly important control is the comparison of Psb28-bound complexes with Psb28-free PSII-M complexes, which has revealed the critical role of the CP47 C-terminus in blocking the Psb28 binding site and preventing reverse assembly processes .
The extended β-hairpin structure formed by CP47, Psb28, and the D1 D-E loop represents a critical structural element in PSII assembly that can be studied through several specialized approaches:
Structural Analysis Methods:
Hydrogen-deuterium exchange mass spectrometry (HDX-MS):
Expose protein complexes to deuterium-containing buffers for varying time periods
Analyze the rate of hydrogen-deuterium exchange in different protein regions
Identify regions with differential solvent accessibility between assembly intermediates
Map changes in the β-hairpin structure during assembly progression
Site-directed mutagenesis approach:
Introduce single amino acid substitutions at key residues in the β-hairpin structure
Express and purify mutant proteins
Assess effects on:
Protein-protein interactions (using pull-down assays)
β-hairpin formation (using CD spectroscopy)
PSII assembly efficiency (using biochemical assays)
Create a comprehensive mutation map of functionally critical residues
Cross-linking combined with mass spectrometry:
Molecular dynamics simulations:
Build atomic models of the β-hairpin structure based on experimental data
Simulate conformational dynamics under various conditions
Predict energetic contributions of specific interactions
Generate hypotheses for experimental validation
By combining these approaches, researchers can develop a comprehensive understanding of how this unique structural element contributes to the directionality of PSII assembly and prevents improper reverse assembly processes.