Recombinant Ceratophyllum demersum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ceratophyllum demersum Photosystem II CP47 Chlorophyll Apoprotein (psbB)

The recombinant Ceratophyllum demersum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered transmembrane protein derived from the rigid hornwort (Ceratophyllum demersum). This protein is a critical component of the Photosystem II (PSII) core complex in oxygenic photosynthesis, playing a central role in light-driven water oxidation and chlorophyll binding . The recombinant form is produced for research and diagnostic applications, including structural studies, functional assays, and antibody development .

Protein Structure and Domains

The psbB protein (UniProt ID: A8SEC9) spans 508 amino acids, forming a transmembrane structure with a His-tag for purification . Key structural features include:

  • Chlorophyll-binding sites: Integral to stabilizing the PSII reaction center and facilitating electron transfer.

  • Interaction with CP43 and D1/D2 proteins: Critical for forming the PSII core complex .

Amino Acid Sequence Highlights
The sequence begins with MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM... and includes conserved motifs for chlorophyll binding and membrane integration .

Functional Role in PSII

psbB (CP47) binds chlorophyll a and stabilizes the PSII reaction center, enabling light-driven water splitting into oxygen, protons, and electrons . It interacts with extrinsic proteins (e.g., PsbO, PsbV) and assembly factors like Psb27 during PSII biogenesis and repair .

Expression and Purification

The recombinant psbB is expressed in E. coli (common host for plant proteins) and purified via affinity chromatography due to its His-tag . Key specifications include:

ParameterValue/Description
Expression HostE. coli
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE verified)
Storage BufferTris-based buffer, 50% glycerol
StabilityStable at -20°C/-80°C; avoid freeze-thaw
ReconstitutionDeionized water (0.1–1.0 mg/mL)

Biochemical Properties

  • Solubility: Requires reconstitution in aqueous buffers with glycerol for stability .

  • Reactivity: Used in ELISA kits for detecting anti-psbB antibodies in environmental or plant-based studies .

Environmental Stress and Gene Regulation

In studies on Chlorella pyrenoidosa, psbB was down-regulated under 17α-estradiol (17α-EE2) stress, highlighting its sensitivity to environmental pollutants . This aligns with broader observations of PSII-related gene suppression under oxidative stress.

Functional Implications

The structural conservation between species underscores psbB’s universal role in PSII but suggests niche adaptations to environmental conditions (e.g., aquatic vs. terrestrial habitats).

Biotechnological Applications

  • ELISA Kits: Used to detect psbB-specific antibodies in plant physiology or environmental monitoring .

  • Structural Biology: Cryo-EM studies leverage recombinant psbB to model PSII assembly and repair .

Environmental and Agricultural Research

  • Biomass Production: Ceratophyllum demersum’s high protein content (e.g., psbB) is exploited in wastewater treatment for nutrient removal .

  • Stress Tolerance: Engineering psbB variants may enhance PSII stability under pollution or climate-driven stressors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Ceratophyllum demersum (Rigid hornwort) (Coontail)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGLWSYEGVAGAHIMFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VSPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGNGLSENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDNEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
CP47 (Photosystem II CP47 chlorophyll apoprotein), encoded by the *psbB* gene, is a crucial component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What role does CP47 play in Photosystem II function and assembly?

CP47 serves as a critical core component of Photosystem II (PSII), which is a light-driven water:plastoquinone oxidoreductase that uses light energy to extract electrons from water molecules, generating oxygen and establishing a proton gradient essential for ATP formation .

Specifically, CP47:

  • Binds chlorophyll molecules and helps catalyze the primary light-induced photochemical processes of PSII

  • Serves as an internal antenna complex that captures light energy and transfers it to the reaction center

  • Provides structural stability to the PSII complex

  • Functions as a binding platform for assembly factors during PSII biogenesis

Research has revealed that the C-terminal region of CP47 plays a crucial role in the directionality of PSII assembly. In mature PSII complexes (PSII-M), the CP47 C-terminus interacts with the D1 D-E loop, which prevents binding of the assembly factor Psb28 and thus inhibits the reverse assembly process .

How does the CP47 protein interact with other components of Photosystem II during assembly?

The assembly of Photosystem II is a sequential, highly coordinated process with CP47 playing a central role in multiple protein-protein interactions:

  • During early assembly stages, CP47 binds to the minimal reaction center complex (RC) to form the RC47a intermediate complex

  • The C-terminus of CP47 interacts with the D1 D-E loop, forming a structural element that influences assembly directionality

  • CP47 serves as a binding platform for multiple assembly factors:

    • Psb28 binds to the cytosolic side of CP47 near the QB binding site

    • Psb34, a single transmembrane helix protein, binds to CP47 in proximity to PsbH

Structural studies have shown that the binding of Psb28 to CP47 induces the formation of an extended β-hairpin structure that incorporates the central antiparallel β-sheet of Psb28, the C-terminus of CP47, and the D1 D-E loop. This interaction is specific to assembly intermediates and is prevented in mature PSII by conformational changes in the CP47 C-terminus .

What are the optimal experimental conditions for studying the binding interaction between CP47 and assembly factors?

Advanced studies of CP47-assembly factor interactions require careful experimental design to capture these often transient interactions. Based on current research approaches:

Nuclear Magnetic Resonance (NMR) Spectroscopy Method:

  • Prepare recombinant Psb28 protein expressed in a cell-free system

  • Synthesize peptides representing the conserved CP47 C-terminus

  • Perform chemical shift perturbation (CSP) experiments to characterize the interaction in detail

  • Determine the dissociation constant (Kd) to quantify binding affinity

Chemical Cross-linking with Mass Spectrometry:

  • Isolate PSII assembly intermediates from Ceratophyllum demersum or model organisms

  • Apply chemical cross-linking agents to stabilize protein-protein interactions

  • Digest the cross-linked proteins with proteases

  • Analyze the resulting peptides using mass spectrometry

  • Identify interaction sites based on cross-linked peptides

When analyzing binding interactions, researchers should maintain physiologically relevant conditions (pH 6.5-7.5, temperature 20-25°C) and consider using detergents compatible with membrane protein studies (e.g., n-dodecyl β-D-maltoside or digitonin) to maintain protein stability while preserving native interactions .

How can researchers effectively isolate and purify recombinant CP47 protein while maintaining its structural integrity?

Isolating and purifying transmembrane proteins like CP47 presents significant challenges due to their hydrophobic nature. A methodological approach includes:

Expression System Selection:

  • Cell-free expression systems have proven effective for recombinant CP47 production, avoiding complications associated with membrane insertion and protein folding in traditional cell-based systems

Purification Protocol:

  • Solubilize the recombinant protein using mild detergents that preserve protein structure (e.g., n-dodecyl β-D-maltoside)

  • Apply affinity chromatography utilizing tags incorporated during expression

  • Implement size exclusion chromatography to separate monomeric protein from aggregates

  • Confirm protein integrity using circular dichroism spectroscopy and fluorescence measurements

Storage Conditions:

  • Store in Tris-based buffer with 50% glycerol optimized for protein stability

  • Maintain at -20°C for long-term storage, or -80°C for extended preservation

  • Avoid repeated freeze-thaw cycles by preparing working aliquots stored at 4°C for up to one week

Research has demonstrated that small volumes of the protein may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap .

What methodological approaches can detect structural changes in CP47 during Photosystem II assembly and repair?

Studying structural dynamics of CP47 during PSII assembly and repair requires specialized techniques:

Cryo-Electron Microscopy (Cryo-EM):

  • Isolate PSII assembly intermediates at different stages

  • Prepare samples by rapid freezing in liquid ethane

  • Collect high-resolution image data using a transmission electron microscope

  • Process images to generate 3D structures

  • Compare structures to identify conformational changes in CP47

Two-dimensional Blue Native/SDS-PAGE Analysis:

  • Isolate thylakoid membranes from Ceratophyllum demersum

  • Solubilize membranes with mild detergents

  • Separate protein complexes using blue native PAGE in the first dimension

  • Perform SDS-PAGE in the second dimension

  • Identify proteins by immunoblotting or mass spectrometry

  • Track CP47 association with different assembly intermediates

Radioactive Pulse-Chase Experiments:

  • Pulse-label newly synthesized proteins with radioactive amino acids

  • Chase with non-radioactive amino acids

  • Isolate PSII complexes at different time points

  • Analyze the incorporation of labeled CP47 into assembly intermediates

  • Track the movement of CP47 through the assembly pathway

These combined approaches have been instrumental in revealing the sequential assembly of PSII complexes and the dynamic role of CP47 in this process .

How does the interaction between CP47 and assembly factor Psb28 prevent photodamage during Photosystem II assembly?

The interaction between CP47 and Psb28 plays a crucial protective role during PSII assembly:

Mechanism of Photodamage Prevention:

  • Psb28 binds to the cytosolic side of CP47, close to cytochrome b559 and the QB binding site

  • This binding effectively blocks electron transport to the acceptor side of PSII

  • By preventing premature electron flow, Psb28 shields the RC47 complex from excess photodamage during assembly

  • This protective mechanism is particularly important because partially assembled PSII complexes lack full photoprotection capabilities

The hypothesis of Psb28's protective role is strengthened by observations that Psb28 is also associated with PSII repair complexes, suggesting a similar function during the repair of photodamaged PSII .

Structural Basis for Protection:
Psb28 binding induces the formation of an extended β-hairpin structure incorporating:

  • The central antiparallel β-sheet of Psb28

  • The C-terminus of CP47

  • The D1 D-E loop

This structural arrangement effectively blocks access to the electron transport chain, preventing premature activation of the complex .

What techniques are most effective for analyzing the chlorophyll-binding properties of recombinant CP47 protein?

Analyzing chlorophyll-binding properties of recombinant CP47 requires specialized spectroscopic techniques:

Absorption Spectroscopy:

  • Prepare purified recombinant CP47 protein in an appropriate buffer

  • Record absorption spectra between 350-750 nm

  • Identify characteristic chlorophyll absorption peaks (approximately 436 nm and 663 nm for chlorophyll a)

  • Calculate chlorophyll:protein ratios based on extinction coefficients

Circular Dichroism (CD) Spectroscopy:

  • Scan both far-UV (190-250 nm) and visible (350-750 nm) regions

  • Far-UV spectra provide information on protein secondary structure

  • Visible region CD spectra reveal information about pigment-protein interactions and the organization of chlorophylls

Fluorescence Spectroscopy:

  • Measure fluorescence emission spectra upon excitation at chlorophyll absorption maxima

  • Analyze fluorescence lifetime using time-resolved fluorescence spectroscopy

  • Perform fluorescence quenching experiments to study energy transfer dynamics

Resonance Raman Spectroscopy:

  • Excite samples at wavelengths corresponding to chlorophyll absorption

  • Analyze vibrational modes associated with chlorophyll-protein interactions

  • Compare spectra with native PSII complexes to assess functional binding

These techniques, when used in combination, provide comprehensive insight into the chlorophyll-binding properties and functional integrity of recombinant CP47 protein.

How does the amino acid sequence of CP47 from Ceratophyllum demersum compare with CP47 from other photosynthetic organisms?

Comparative analysis of CP47 sequences across photosynthetic organisms reveals patterns of conservation reflecting the protein's critical role in photosynthesis:

Sequence Conservation Analysis:

Organism TypeSequence Identity with C. demersum CP47Highly Conserved Regions
Higher plants90-98%Chlorophyll-binding sites, D1 interaction domains
Green algae80-90%Transmembrane helices, cofactor coordination sites
Cyanobacteria70-85%Core structural elements, energy transfer pathways
Diatoms65-75%Transmembrane domains, selected binding sites

The high degree of conservation, particularly in transmembrane regions and cofactor-binding sites, underscores the fundamental importance of CP47 structure for PSII function across diverse photosynthetic lineages.

Functionally Significant Variations:

  • N-terminal and C-terminal regions show higher variability, reflecting adaptation to different membrane environments

  • Loop regions connecting transmembrane helices display organism-specific variations that may relate to interactions with lineage-specific assembly factors

  • Certain chlorophyll-binding residues show subtle variations that may fine-tune light-harvesting properties for different ecological niches

These comparative analyses provide valuable insights for researchers studying the evolution of photosynthetic systems and can guide mutagenesis studies targeting specific functional domains.

What is the potential of Ceratophyllum demersum extracts in cancer research, and how does this relate to photosynthetic proteins like CP47?

Recent research has revealed promising anticancer properties of Ceratophyllum demersum extracts, opening new research directions:

Anticancer Properties:
Ethanolic extracts of C. demersum have demonstrated significant anticancer activity, particularly against gastrointestinal tract cancer cells. Flow cytometry analysis of treated cells showed an increased percentage of late apoptotic and necrotic cells, indicating potential therapeutic applications .

Phytochemical Composition:
LC-MS analysis of C. demersum ethanolic extract revealed high content of phenolic compounds (18.50 mg/g), with flavonoids comprising the majority (16.09 mg/g). Newly identified compounds in this plant include:

  • Isorhamnetin

  • Sakuranetin

  • Taxifolin

  • Eriodictyol

Connection to Photosynthetic Proteins:
While direct links between CP47 and anticancer activity remain unexplored, research suggests potential connections:

  • Stress responses in photosynthetic machinery may trigger production of secondary metabolites with bioactive properties

  • Proteins like CP47 may contain bioactive peptide sequences that could be released during extract preparation

  • Understanding how environmental conditions affect both photosynthetic protein expression and secondary metabolite production could optimize harvesting for pharmaceutical applications

Safety Profile:
Fish embryo toxicity (FET) tests showed that C. demersum extract is safe for Danio rerio fish up to concentrations of 225 μg/ml, suggesting potential environmental compatibility for large-scale cultivation .

These findings position C. demersum as a promising source of anticancer compounds with chemopreventive potential, warranting further investigation into the relationship between photosynthetic function and bioactive compound production .

How can advanced structural biology techniques contribute to understanding the molecular mechanisms of photosystem II assembly involving CP47?

Advanced structural biology approaches offer powerful tools for elucidating PSII assembly mechanisms:

Time-Resolved Cryo-Electron Microscopy:

  • Capture assembly intermediates at millisecond to second timescales

  • Generate structural movies of assembly processes

  • Visualize conformational changes in CP47 during complex formation

  • Identify transient interaction interfaces with assembly factors

Integrative Structural Biology Approach:

TechniqueApplication to CP47 ResearchKey Insights
Single-particle cryo-EMHigh-resolution structure determination of assembly intermediatesBinding sites of assembly factors, conformational changes during assembly
Cross-linking mass spectrometryMapping protein-protein interaction networksIdentification of assembly factor binding sites on CP47
Hydrogen-deuterium exchange mass spectrometryProbing dynamic regions of CP47Flexibility changes during assembly, solvent-accessible regions
Molecular dynamics simulationsModeling conformational dynamicsEnergy landscapes of structural transitions, effect of mutations

The recent identification of the single transmembrane helix protein Psb34 bound to a PSII assembly intermediate represents an important advance achieved through these approaches. This protein was previously overlooked due to its hydrophobicity and small size but has now been confirmed to interact with CP47 and play a specific role in the attachment of CP43 to RC47 .

What methodological challenges exist in studying the directionality of PSII assembly processes involving CP47, and how can they be addressed?

Investigating the directionality of PSII assembly presents several methodological challenges:

Key Challenges and Solutions:

  • Capturing transient assembly intermediates:

    • Challenge: Assembly intermediates are often present in low abundance and exist transiently

    • Solution: Employ synchronization techniques like controlled light/dark transitions combined with rapid isolation methods to enrich specific intermediates

  • Distinguishing assembly from repair processes:

    • Challenge: Similar intermediates appear in both de novo assembly and repair pathways

    • Solution: Use pulse-chase experiments with differentially labeled amino acids to distinguish newly synthesized from recycled components

  • Recreating membrane environments:

    • Challenge: Membrane protein interactions depend on lipid environments difficult to preserve in vitro

    • Solution: Utilize nanodiscs or liposomes with defined lipid compositions to mimic native thylakoid membrane environments

  • Monitoring directional assembly in real-time:

    • Challenge: Traditional structural methods provide static snapshots rather than dynamic processes

    • Solution: Implement single-molecule FRET (Förster Resonance Energy Transfer) to track protein-protein interactions during assembly

  • Understanding the role of CP47 C-terminus:

    • Challenge: The C-terminus of CP47 blocks the Psb28 binding site in mature PSII (PSII-M) by interacting with the D1 D-E loop, preventing reverse assembly, but the molecular mechanism is unclear

    • Solution: Develop site-specific crosslinking methods targeting the CP47 C-terminus to capture its dynamic interactions during assembly progression

Recent advances in nuclear magnetic resonance (NMR) spectroscopy, particularly chemical shift perturbation (CSP) experiments with recombinant Psb28 and synthetic peptides of the conserved CP47 C-terminus, have begun to address these challenges by characterizing these interactions in detail and determining dissociation constants .

What controls should be incorporated when studying the function of recombinant CP47 in photosystem II assembly?

Robust experimental design for CP47 functional studies requires careful consideration of controls:

Essential Experimental Controls:

  • Negative controls:

    • CP47-depleted PSII preparations to establish baseline assembly efficiency

    • Heat-denatured recombinant CP47 to confirm structure-dependent functions

    • Non-binding mutants of assembly factors to validate interaction specificity

  • Positive controls:

    • Native CP47 isolated from Ceratophyllum demersum thylakoids

    • Well-characterized model organism CP47 (e.g., from Synechocystis sp. PCC 6803)

    • Reconstituted PSII complexes with established assembly properties

  • Specificity controls:

    • Competitive binding assays with CP47 peptide fragments

    • Cross-validation with multiple assembly factors

    • Comparison across different photosynthetic organisms

  • Quantitative controls:

    • Standardized protein concentration determinations

    • Calibrated spectroscopic measurements

    • Internal standards for mass spectrometry

A particularly important control is the comparison of Psb28-bound complexes with Psb28-free PSII-M complexes, which has revealed the critical role of the CP47 C-terminus in blocking the Psb28 binding site and preventing reverse assembly processes .

How can researchers effectively study the role of the extended β-hairpin structure formed by CP47, Psb28, and the D1 D-E loop?

The extended β-hairpin structure formed by CP47, Psb28, and the D1 D-E loop represents a critical structural element in PSII assembly that can be studied through several specialized approaches:

Structural Analysis Methods:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Expose protein complexes to deuterium-containing buffers for varying time periods

    • Analyze the rate of hydrogen-deuterium exchange in different protein regions

    • Identify regions with differential solvent accessibility between assembly intermediates

    • Map changes in the β-hairpin structure during assembly progression

  • Site-directed mutagenesis approach:

    • Introduce single amino acid substitutions at key residues in the β-hairpin structure

    • Express and purify mutant proteins

    • Assess effects on:

      • Protein-protein interactions (using pull-down assays)

      • β-hairpin formation (using CD spectroscopy)

      • PSII assembly efficiency (using biochemical assays)

    • Create a comprehensive mutation map of functionally critical residues

  • Cross-linking combined with mass spectrometry:

    • Use zero-length or short-distance crosslinkers to capture interactions

    • Apply to both in vitro reconstituted systems and isolated complexes

    • Identify specific amino acid contacts within the β-hairpin structure

  • Molecular dynamics simulations:

    • Build atomic models of the β-hairpin structure based on experimental data

    • Simulate conformational dynamics under various conditions

    • Predict energetic contributions of specific interactions

    • Generate hypotheses for experimental validation

By combining these approaches, researchers can develop a comprehensive understanding of how this unique structural element contributes to the directionality of PSII assembly and prevents improper reverse assembly processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.