Recombinant Ceratotherium simum ATP synthase subunit a (MT-ATP6)

What is Recombinant Ceratotherium simum ATP synthase subunit a and what is its significance?

Recombinant Ceratotherium simum ATP synthase subunit a (MT-ATP6) is a mitochondrially encoded protein that serves as a critical component of the F-type ATP synthase complex. This protein forms part of the Fo sector, which is responsible for proton translocation across the inner mitochondrial membrane. The Fo sector works in concert with the F1 sector to drive the rotary mechanism essential for ATP synthesis. The recombinant form is produced through an in vitro Escherichia coli expression system, resulting in a full-length protein spanning amino acid residues 1-226 with an N-terminal 10xHis tag for purification purposes .

The significance of studying rhinoceros MT-ATP6 lies in understanding evolutionary conservation patterns of this essential bioenergetic protein across mammalian species. While core ATP synthase components are generally conserved across prokaryotes and eukaryotes, comparative studies between species can reveal important lineage-specific adaptations. Research on this protein contributes to our understanding of mitochondrial energy production mechanisms in endangered megafauna and provides insights into the molecular basis of cellular bioenergetics across diverse taxa.

How is the protein structure characterized and what are its key domains?

The Ceratotherium simum MT-ATP6 protein consists of 226 amino acids with a predicted structure featuring multiple transmembrane domains. The amino acid sequence (MNENLFTSFATPTIMGLPIVILIIMFPSIMFPSPNRLINNRLVSTQQWLLQLTSKQMLSIHNNKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVFLGFRHKTKASLAHFLPQGTPVFLIPMLVIIETISLFIQPVALAVRLTANITAGHLLMHLIGGATLALMNISPTTALITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT) suggests a protein rich in hydrophobic residues, consistent with its role as a transmembrane component .

Analyzing the sequence through secondary structure prediction algorithms would reveal multiple transmembrane helices that form proton-conducting channels in the functional complex. Comparative analysis with ATP synthase subunit a from other organisms suggests conserved arginine residues that are critical for proton translocation. It should be noted that structural characterization of membrane proteins like MT-ATP6 presents significant technical challenges, often requiring specialized approaches such as cryo-electron microscopy or X-ray crystallography combined with stabilizing detergents or lipid nanodiscs.

What expression systems are optimal for producing functional recombinant MT-ATP6?

For MT-ATP6, which is a hydrophobic membrane protein, expression systems that excel at membrane protein production (such as specialized E. coli strains with modified membranes or yeast systems) may be preferable. Codon optimization based on the host expression system is essential for efficient translation, particularly when expressing rhinoceros proteins in microbial systems. Additionally, fusion tags beyond the His-tag (such as MBP or SUMO) might improve solubility and folding.

How can researchers verify the functional integrity of recombinant MT-ATP6?

Verifying the functional integrity of recombinant MT-ATP6 requires multiple approaches, as the protein's native function occurs within the context of the complete ATP synthase complex. Researchers might employ the following methodologies:

• Reconstitution assays: Incorporating the recombinant protein into liposomes along with other ATP synthase subunits to test for proton translocation activity, which can be measured using pH-sensitive fluorescent dyes.

• Complementation studies: Testing the ability of the recombinant protein to restore functionality in ATP synthase-deficient cell lines or bacterial strains.

• Binding assays: Evaluating the protein's ability to interact with other ATP synthase subunits using techniques such as co-immunoprecipitation, surface plasmon resonance, or crosslinking studies.

• Spectroscopic analyses: Circular dichroism spectroscopy can assess whether the recombinant protein has adopted the expected secondary structure, particularly the alpha-helical content typical of transmembrane domains.

Similar methodologies have been successfully employed in studies of ATP synthase from other organisms, such as the highly divergent ATP synthase complex in Tetrahymena thermophila, where researchers used techniques including Blue Native PAGE and in-gel activity assays to assess integrity and function .

What analytical techniques are most effective for studying MT-ATP6 structure-function relationships?

Given the challenges of working with membrane proteins like MT-ATP6, researchers should consider a multi-technique approach to elucidate structure-function relationships:

For studying proton translocation specifically, researchers might employ electrophysiological techniques such as patch-clamp or solid-supported membrane electrophysiology after reconstitution of the protein into lipid bilayers. Alternatively, fluorescent probes sensitive to membrane potential or pH can provide insights into the functional aspects of proton movement.

The approach used to study Tetrahymena ATP synthase complexes through BN-PAGE, single-particle electron microscopy, and proteomic analyses provides a practical methodology that could be adapted for studying rhinoceros MT-ATP6 within its complete complex .

How does Ceratotherium simum MT-ATP6 compare with its orthologs in other mammals?

Comparative analysis of MT-ATP6 across mammalian species can provide insights into evolutionary conservation and functional constraints. While specific data comparing rhinoceros MT-ATP6 with other mammals is not provided in the search results, we can outline the methodological approach:

• Sequence alignment analysis: Multiple sequence alignment of MT-ATP6 sequences from diverse mammals would reveal conserved residues likely critical for function versus variable regions that may relate to species-specific adaptations.

• Phylogenetic analysis: Construction of phylogenetic trees based on MT-ATP6 sequences could help understand evolutionary relationships and rates of sequence divergence, similar to the phylogenetic analyses conducted for ATP synthase subunits β, γ, δ, and c in other organisms .

• Structural comparison: Homology modeling based on available structures of ATP synthase from other organisms can highlight structural conservation and differences.

• Positive selection analysis: Statistical methods such as calculation of dN/dS ratios can identify residues under positive selection, which might indicate adaptive evolution.

An interesting observation from studies of other organisms is that while the F1 sector of ATP synthase tends to be highly conserved, the Fo sector (where MT-ATP6 resides) shows greater variability across evolutionary distances. For example, the ATP synthase from Tetrahymena thermophila exhibits dramatic structural differences compared to those from other organisms, despite core functional similarities .

What strategies can address the challenges of expressing and purifying functional MT-ATP6?

Membrane proteins like MT-ATP6 present significant challenges for expression and purification. Advanced researchers should consider these methodological approaches:

• Fusion protein strategies: Engineering constructs with fusion partners known to improve membrane protein expression, such as Mistic, GFP, or SUMO. These fusions can enhance protein folding, monitor expression levels, and improve solubility.

• Specialized expression strains: Utilizing E. coli strains specifically designed for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3), which have modifications to accommodate the additional membrane protein burden.

• Co-expression systems: Simultaneously expressing multiple components of the ATP synthase complex may improve stability and folding of MT-ATP6 through proper protein-protein interactions.

• Nanodiscs and other membrane mimetics: Incorporating the purified protein into nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs) can maintain the native-like lipid environment crucial for membrane protein stability.

• High-throughput optimization: Systematic testing of expression conditions including temperature, induction timing, media composition, and detergent screening can identify optimal parameters for functional protein production.

The purification strategy would typically involve initial solubilization with carefully selected detergents, followed by immobilized metal affinity chromatography utilizing the N-terminal 10xHis-tag, and subsequent size exclusion chromatography to isolate properly folded protein .

How can researchers investigate the interaction between MT-ATP6 and other ATP synthase subunits?

Understanding the interactions between MT-ATP6 and other components of the ATP synthase complex requires sophisticated methodological approaches:

• Crosslinking mass spectrometry (XL-MS): This technique can capture spatial relationships between subunits by forming covalent bonds between nearby residues, followed by identification of cross-linked peptides through mass spectrometry.

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): By measuring the rate of hydrogen-deuterium exchange at peptide backbones, researchers can identify regions involved in protein-protein interactions, which typically show reduced exchange rates.

• Förster resonance energy transfer (FRET): Labeling MT-ATP6 and potential interaction partners with appropriate fluorophores allows for detection of proximity-dependent energy transfer, indicating close association between proteins.

• Native mass spectrometry: This technique can maintain non-covalent interactions during ionization, allowing direct observation of intact protein complexes and subcomplexes.

• Computational approaches: Protein-protein docking algorithms, guided by experimental constraints, can predict interaction interfaces and generate structural models of subunit assemblies.

The approach demonstrated in the Tetrahymena ATP synthase study, which combined BN-PAGE with proteomic analysis to identify previously unknown components of the complex, provides an excellent template for studying novel interactions in the rhinoceros ATP synthase complex .

What experimental approaches can elucidate the proton translocation mechanism in ATP synthase incorporating recombinant MT-ATP6?

Investigating the proton translocation mechanism requires specialized techniques that can detect proton movement and correlate it with structural changes:

• Site-directed mutagenesis of conserved residues: Systematically mutating key amino acids predicted to be involved in proton translocation, particularly conserved charged residues, followed by functional assays to assess the impact on proton conductance.

• Reconstitution into proteoliposomes: Incorporating purified MT-ATP6 (along with other necessary subunits) into liposomes with entrapped pH-sensitive fluorescent dyes to directly measure proton movement.

• Solid-supported membrane electrophysiology: This technique can measure currents generated by proton translocation across membranes containing reconstituted ATP synthase complexes.

• Time-resolved spectroscopy: Using spectroscopic techniques to monitor conformational changes in labeled proteins during the catalytic cycle, potentially correlating these changes with proton movement.

• Computational simulations: Molecular dynamics simulations can model proton movement through the transmembrane channel formed by MT-ATP6 and adjacent subunits, identifying key interactions and energy barriers.

The unusual resistance to canonical F-type ATP synthase inhibitors (such as oligomycin and sodium azide) observed in Tetrahymena raises interesting questions about potential structural differences in the proton translocation pathway that could be explored in comparative studies with rhinoceros MT-ATP6.

How does MT-ATP6 contribute to dimer formation and cristae shaping in mitochondria?

ATP synthase dimers play a crucial role in shaping mitochondrial cristae. Research methodologies to investigate the contribution of MT-ATP6 to these processes include:

• Cryo-electron tomography: This technique can visualize the arrangement of ATP synthase dimers in native-like membrane environments, potentially revealing the specific contribution of MT-ATP6 to dimer formation and membrane curvature.

• Disulfide crosslinking: Introducing cysteine residues at predicted dimer interface sites in MT-ATP6 followed by oxidation-induced crosslinking can test specific structural models of dimer formation.

• Lipid-protein interaction studies: Techniques such as lipid mass spectrometry or native nanodiscs can identify specific lipids that interact with MT-ATP6 and potentially mediate dimer formation or stabilization.

• Mitochondrial ultrastructure analysis: Examining the effects of MT-ATP6 mutations or deletions on cristae morphology using electron microscopy can reveal its role in membrane architecture.

The study of Tetrahymena ATP synthase revealed a unique parallel disposition of individual ATP synthase monomers, in contrast to the angular arrangement seen in other organisms . This structural difference correlates with the tubular cristae found in Tetrahymena mitochondria versus the curved cristae tips in other organisms. This observation suggests that the arrangement of ATP synthase dimers directly influences mitochondrial membrane morphology, making this an intriguing area for comparative studies with rhinoceros MT-ATP6.

How should researchers design experiments to study MT-ATP6 mutations and their functional impact?

When investigating MT-ATP6 mutations, whether naturally occurring or engineered, researchers should implement a systematic experimental design:

• Selection of mutation sites: Choose residues based on:

  • Conservation analysis across species

  • Structural predictions of functional importance

  • Known pathogenic mutations in human orthologs

  • Computational predictions of stability and function

• Mutation strategy matrix:

• Readout systems: Employ multiple complementary approaches to assess functional impact:

  • ATP synthesis/hydrolysis rates

  • Proton translocation efficiency

  • Complex assembly and stability

  • Structural changes via spectroscopic methods

• Controls: Include appropriate controls such as wild-type protein, known non-functional mutants, and mutations in non-conserved regions predicted to have minimal impact.

This methodical approach facilitates rigorous analysis of structure-function relationships and allows for mechanistic interpretations of the results.

What are the optimal conditions for storing and handling recombinant MT-ATP6 to maintain functionality?

The proper storage and handling of recombinant MT-ATP6 is critical for maintaining its structural integrity and function. Based on the information provided:

• Storage temperature: Store at -20°C/-80°C upon receipt . The lower temperature (-80°C) is preferable for long-term storage of membrane proteins.

• Physical state considerations:

  • Lyophilized form: Has a shelf life of approximately 12 months at -20°C/-80°C

  • Liquid form: Has a reduced shelf life of approximately 6 months at -20°C/-80°C

• Buffer composition: The product is typically lyophilized from Tris/PBS-based buffer with 6% trehalose at pH 8.0 . When reconstituting or working with the protein:

  • Maintain pH between 7.5-8.0

  • Include stabilizing agents such as glycerol (10-20%)

  • Consider adding specific lipids that may enhance stability

• Handling recommendations:

  • Avoid repeated freeze-thaw cycles

  • Aliquot the protein solution upon initial thawing

  • When working with the protein, keep samples on ice

  • For membrane proteins, maintain appropriate detergent concentrations above the critical micelle concentration

• Monitoring stability: Implement regular quality control measures such as:

  • SDS-PAGE to check for degradation

  • Circular dichroism to assess secondary structure retention

  • Limited functional assays to confirm activity maintenance

These guidelines ensure optimal protein integrity throughout the research process, particularly important for membrane proteins that are inherently less stable when removed from their native lipid environment.

How might comparative studies of MT-ATP6 across endangered species inform conservation efforts?

Comparative analysis of MT-ATP6 across endangered species, particularly within rhinoceros species, could provide valuable insights for conservation biology:

• Genetic diversity assessment: Analyzing MT-ATP6 sequence variations within and between rhinoceros populations can serve as a marker for mitochondrial genetic diversity, which is crucial for population health and adaptability.

• Adaptive evolution identification: Detecting signatures of positive selection in MT-ATP6 might reveal adaptations to specific environmental conditions or metabolic demands, informing habitat management strategies.

• Functional consequences of variants: Experimental characterization of naturally occurring MT-ATP6 variants could identify potentially deleterious mutations that might impact population fitness through effects on bioenergetic efficiency.

• Biomarker development: Knowledge of MT-ATP6 structure and function could lead to the development of non-invasive biomarkers for monitoring rhinoceros health, particularly related to mitochondrial function and energetic status.

• Ex-situ conservation programs: Understanding the molecular details of rhinoceros bioenergetics could inform captive breeding programs, particularly in optimizing nutrition and environmental conditions to match metabolic requirements.

This research direction represents a unique intersection of molecular biology, evolutionary genetics, and conservation science, potentially contributing valuable tools for the preservation of endangered megafauna.

What emerging technologies might advance our understanding of MT-ATP6 structure and function?

Several cutting-edge technologies show promise for deepening our understanding of MT-ATP6:

• Cryo-electron microscopy advances: Continued improvements in resolution and sample preparation techniques are making it increasingly feasible to obtain high-resolution structures of membrane protein complexes like ATP synthase without crystallization.

• Single-molecule techniques: Methods such as single-molecule FRET and high-speed atomic force microscopy can provide dynamic information about conformational changes during the catalytic cycle.

• Artificial intelligence applications: AI-powered protein structure prediction tools (like AlphaFold2) and molecular dynamics simulations can generate increasingly accurate models of protein structures and dynamics, even for challenging membrane proteins.

• Gene editing technologies: CRISPR-Cas9 and base editing technologies enable precise modification of endogenous MT-ATP6 in cell lines, allowing for the study of mutations in a native context.

• Integrative structural biology: Combining multiple experimental techniques (X-ray crystallography, NMR, cryo-EM, crosslinking-MS, etc.) with computational modeling to generate comprehensive structural models.

These technological advances promise to overcome many of the traditional challenges associated with studying membrane proteins like MT-ATP6, potentially leading to breakthroughs in our understanding of mitochondrial ATP synthesis and its evolutionary variations.