Recombinant Ceratotherium simum NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Properties

As a component of Complex I (NADH dehydrogenase), MT-ND4L plays a crucial role in the first step of the mitochondrial electron transport chain . This complex functions by transferring electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane. This process contributes to the generation of the proton gradient that drives ATP synthesis, the primary energy currency of cells. The enzyme activity is classified under EC number 1.6.5.3, which designates NADH-ubiquinone oxidoreductase activity .

Expression Systems

Recombinant Ceratotherium simum MT-ND4L can be produced using various expression systems, each offering distinct advantages depending on the intended application. The primary production platforms include:

Expression SystemAdvantagesCommon Applications
E. coliRapid growth, high yield, cost-effectiveBasic research, antibody production
YeastPost-translational modifications, secretionStructural studies, functional assays
BaculovirusComplex proteins, eukaryotic modificationsProtein-protein interaction studies
Mammalian CellNative folding, authentic modificationsTherapeutic research, complex functional studies

All these expression systems have been successfully employed to produce recombinant MT-ND4L protein with purity levels typically exceeding 85% as determined by SDS-PAGE analysis .

White Rhinoceros Mitochondrial Genome

The MT-ND4L gene is part of the complete mitochondrial genome of Ceratotherium simum, which has been fully sequenced and characterized . The complete mitochondrial DNA sequence of the white rhinoceros spans 16,832 nucleotides, although this length can vary due to pronounced heteroplasmy caused by differing numbers of a repetitive motif (5'-CG-CATATACA-3') in the control region . The mitochondrial genome of C. simum, like other mammalian mitochondrial genomes, contains 37 genes: 13 protein-coding genes (including MT-ND4L), 22 tRNA genes, and 2 rRNA genes .

Comparative genomic studies between the white rhinoceros (Ceratotherium simum) and Indian rhinoceros (Rhinoceros unicornis) mitochondrial genomes have provided valuable insights into the evolutionary history of rhinoceros species. These analyses suggest that the basal evolutionary divergence among extant rhinoceroses occurred approximately 27 million years before present . This evolutionary context adds significant value to the study of MT-ND4L and other mitochondrial proteins in rhinoceros species.

Conservation Applications

Research on rhinoceros mitochondrial proteins, including MT-ND4L, has potential applications in conservation biology. The BioRescue consortium, for example, is working to develop advanced methods of assisted reproduction to save the northern white rhinoceros from extinction . While not directly focusing on MT-ND4L, their work with induced pluripotent stem cells (iPSCs) from northern white rhinoceros demonstrates the importance of understanding rhinoceros cellular biology at the molecular level . Knowledge of mitochondrial proteins like MT-ND4L could potentially contribute to these conservation efforts by providing insights into cellular energy metabolism and mitochondrial function in rhinoceros tissues.

Role in Complex I

MT-ND4L functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . This complex is the largest of the electron transport chain complexes, comprising multiple subunits that work together to catalyze the transfer of electrons from NADH to ubiquinone. The protein is believed to belong to the minimal assembly required for catalysis, making it essential for Complex I function .

The protein's role within Complex I involves:

  1. Contributing to the formation of proton-pumping channels

  2. Participating in the electron transfer pathway

  3. Maintaining the structural integrity of the membrane domain of Complex I

  4. Potentially contributing to the coupling of electron transfer to proton translocation

Interaction Network

Protein interaction studies, particularly those conducted on human MT-ND4L, reveal that this protein interacts extensively with other components of Complex I and the respiratory chain . Key interaction partners include:

  1. NDUFS3 - NADH dehydrogenase iron-sulfur protein 3

  2. NDUFS8 - NADH dehydrogenase iron-sulfur protein 8

  3. MT-CYB - Cytochrome b

  4. MT-ATP6 - ATP synthase subunit a

  5. MT-ND6 - NADH-ubiquinone oxidoreductase chain 6

  6. MT-ND1 - NADH-ubiquinone oxidoreductase chain 1

  7. MT-ND5 - NADH-ubiquinone oxidoreductase chain 5

  8. MT-ND4 - NADH-ubiquinone oxidoreductase chain 4

  9. MT-ND2 - NADH-ubiquinone oxidoreductase chain 2

  10. MT-ND3 - NADH-ubiquinone oxidoreductase chain 3

These interactions highlight the integrated nature of MT-ND4L within the mitochondrial respiratory machinery and underscore its importance in cellular energy production.

Research Applications

The recombinant MT-ND4L protein serves various research purposes:

  1. Antibody Production: The purified protein can be used as an immunogen for generating specific antibodies against MT-ND4L, which are valuable tools for studying Complex I function and localization.

  2. Functional Studies: The recombinant protein can be employed in enzymatic assays to study the catalytic properties of Complex I and to investigate the specific contribution of MT-ND4L to electron transport and proton pumping.

  3. Structural Analysis: The availability of purified recombinant protein facilitates structural studies using techniques such as X-ray crystallography or cryo-electron microscopy, contributing to our understanding of Complex I architecture.

  4. Mitochondrial Disease Research: As mutations in mitochondrial genes, including MT-ND4L, are associated with various mitochondrial disorders, the recombinant protein provides a valuable resource for investigating disease mechanisms.

  5. Evolutionary Studies: Comparative analysis of MT-ND4L from different species, including the white rhinoceros, contributes to our understanding of mitochondrial evolution and the functional conservation of respiratory chain components.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)
Target Names
Target Protein Sequence
MSLIHINVFLAFTTSLMGLLMYRSHLMSSLLCLEGMMLSLFIMATMMVLNSHFTLASMMP IILLVFAACEAALGLSLLVMISNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.