Recombinant Ceratotherium simum NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant MT-ND6 is a core subunit of mitochondrial Complex I (NADH dehydrogenase), essential for electron transfer from NADH to ubiquinone in the respiratory chain . Produced via heterologous expression systems like E. coli, it retains functional properties of the native protein, facilitating biochemical and structural studies .

Functional Role in Complex I

MT-ND6 contributes to:

  • Electron Transfer: Mediates electron movement from FMN to ubiquinone via Fe-S clusters .

  • Proton Pumping: Conformational changes during electron transport enable hydrogen ion translocation .

  • Structural Stability: Forms part of Complex I’s transmembrane core, critical for assembly .

Deficiencies in MT-ND6 disrupt ATP synthesis and increase reactive oxygen species (ROS), implicated in Leber’s hereditary optic neuropathy (LHON) and Leigh syndrome .

Research Applications

Recombinant MT-ND6 is utilized in:

  • Enzyme Kinetics: Studying ubiquinone binding and electron transfer efficiency .

  • Disease Modeling: Investigating LHON-linked mutations (e.g., T14484C, G14459A) .

  • Structural Biology: Resolving transmembrane domain interactions via cryo-EM or X-ray crystallography .

  • Diagnostic Development: Serving as an antigen in ELISA assays for mitochondrial disorder biomarkers .

Clinical Relevance

While recombinant MT-ND6 itself is not therapeutic, its study clarifies disease mechanisms:

  • LHON: The T14484C mutation reduces ubiquinone binding, impairing ATP production .

  • Leigh Syndrome: G14459A alters Complex I assembly, leading to neurodegeneration .

Limitations and Challenges

  • Tag Interference: Affinity tags may affect native protein conformation .

  • Storage Sensitivity: Requires strict -80°C storage to prevent aggregation .

  • Species Variability: C. simum MT-ND6 may exhibit slight functional differences from human orthologs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Ceratotherium simum (White rhinoceros) (Square-lipped rhinoceros)
Target Names
Target Protein Sequence
MMAYIGFILSIMFVISFVGFSSKPSPIYGGLVLIMSGGFGCGIVMSFGGSFLGLMVFLIY LGGMLVVFGYTTAMATEQYPEVWVSSAAVLGAFVLGVLMEVVLVLYVYKNGEVEVVFNFS GVGDWAVSDNGGFGVFSEEIVGVSALYSYGVWIIIVTGWSLFVGVLVILEITRGA
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity and assembly of complex I.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND6 and what is its role in mitochondrial function?

MT-ND6 is a mitochondrially encoded subunit of Complex I (NADH-ubiquinone oxidoreductase) located at the junction between the P and Q modules of the respiratory chain. It plays a crucial role in creating the E-channel that allows electron flow in Complex I . As part of the mitochondrial respiratory chain, MT-ND6 contributes to energy production through oxidative phosphorylation. The protein contains multiple alpha helices involved in interactions with other Complex I subunits, particularly those in the Q module . Mutations in this gene have been associated with various mitochondrial disorders, demonstrating its essential function in cellular energy metabolism.

How does the structure of MT-ND6 contribute to Complex I stability?

The structural integrity of MT-ND6, particularly its C-terminal region, is critical for maintaining Complex I stability. Research using molecular dynamics simulations has shown that the C-terminus contains three alpha helices involved in interactions with the Q module of Complex I . Truncation of this region results in conformational rearrangements rather than complete protein unfolding, leading to the loss of approximately one-quarter of the original contacts with neighboring subunits . These structural changes negatively impact the assembly and stability of the entire 45-subunit complex, ultimately affecting its electron transport function and energy production capacity.

How are MT-ND6 mutations identified and characterized in research settings?

Identification and characterization of MT-ND6 mutations typically involve a multi-step process:

  • DNA extraction from tissue samples or cell cultures using standardized kits (e.g., NucleoSpin Plasmid kit)

  • Mitochondrial genome sequencing using next-generation sequencing platforms (e.g., HiSeq X)

  • Bioinformatic analysis:

    • Quality filtering with tools like Trimgalore

    • Alignment to reference genomes using BWA-MEM

    • Variant calling using tools like GATK HaplotypeCaller and Mutect2

  • Functional validation through:

    • Western blotting to confirm protein expression

    • Blue Native PAGE to assess complex assembly

    • Enzyme activity assays to measure functional impact

This comprehensive approach allows researchers to correlate specific mutations with their structural and functional consequences.

What are the optimal experimental designs for studying MT-ND6 function and mutations?

Robust experimental design for MT-ND6 research requires careful consideration of several key elements:

  • Variable identification and control: Clearly define independent variables (e.g., mutation type, heteroplasmy level) and dependent variables (e.g., Complex I activity, ATP production)

  • Hypothesis formulation: Develop testable null and alternative hypotheses about MT-ND6 function

  • Treatment design: Systematically manipulate variables such as mutation types or heteroplasmy levels

  • Randomization: Implement randomization strategies to minimize bias

  • Cellular models: Utilize cybrid technology to study mutation effects in controlled nuclear backgrounds

For MT-ND6 studies specifically, a comparative design examining wild-type versus mutant forms is most effective, with heteroplasmy levels carefully controlled to elucidate threshold effects . Longitudinal designs may also be valuable for studying progressive phenotypes associated with MT-ND6 mutations.

How can cybrid technology be optimized for studying MT-ND6 mutations?

Cybrid (cytoplasmic hybrid) technology represents a powerful approach for studying MT-ND6 mutations by allowing researchers to examine mitochondrial mutations in a consistent nuclear background. The optimization process involves:

  • Cell preparation: Generate mtDNA-depleted recipient cells (ρ0 cells) using ethidium bromide or other mtDNA depletion methods

  • Donor selection: Obtain platelets or enucleated cells containing the MT-ND6 mutation of interest

  • Fusion optimization: Use polyethylene glycol or electrical pulse methods to fuse ρ0 cells with donor cytoplasts

  • Clone selection: Isolate and expand individual cybrid clones with different heteroplasmy levels

  • Heteroplasmy verification: Quantify mutation loads using techniques such as tetra-primer amplification refractory mutation system-quantitative PCR

  • Functional assessment: Conduct comprehensive mitochondrial function analysis at "transcriptomic, metabolomic, and biochemical levels"

This approach allows for precise determination of mutation-specific effects by creating cell lines with varying levels of MT-ND6 mutation load, critical for establishing threshold effects.

What methodologies are recommended for recombinant expression of Ceratotherium simum MT-ND6?

Recombinant expression of hydrophobic mitochondrial proteins like MT-ND6 presents significant challenges but can be achieved through:

  • Vector selection: Use specialized expression vectors with strong promoters and appropriate tags for detection and purification

  • Expression system optimization:

    • Bacterial systems: Modified E. coli strains (C41/C43) designed for membrane protein expression

    • Eukaryotic systems: Insect cells (Sf9, High Five) or yeast (P. pastoris) for better folding

  • Solubilization strategies:

    • Fusion partners (MBP, GST) to enhance solubility

    • Amphipathic detergents for membrane protein isolation

  • Purification protocol:

    • Two-step affinity chromatography

    • Size exclusion chromatography for final purification

  • Functional validation: Activity assays comparing recombinant protein to native MT-ND6

For functional studies, incorporation into proteoliposomes or nanodiscs may be necessary to maintain the protein in a native-like lipid environment for accurate functional assessment.

How can molecular dynamics simulations be applied to study MT-ND6 mutations?

Molecular dynamics (MD) simulations provide valuable insights into the structural consequences of MT-ND6 mutations:

  • System preparation:

    • Build wild-type and mutant MT-ND6 models based on available structures

    • Embed proteins in appropriate membrane environments

    • Add water molecules and ions to mimic physiological conditions

  • Simulation parameters:

    • Run simulations for sufficient time to observe conformational changes (typically 100-500 ns)

    • Use appropriate force fields optimized for membrane proteins

    • Maintain constant temperature and pressure conditions

  • Analysis approaches:

    • Residual Mean Square Fluctuation (RMSF) to identify regions with increased mobility

    • Solvent Accessible Surface Area (SASA) to assess conformational compactness

    • Native contact preservation to quantify structural changes

    • Hydrogen bond network analysis to evaluate protein stability

  • Interpretation guidelines:

    • Compare wild-type and mutant simulations using the same parameters

    • Correlate structural changes with experimental functional data

    • Consider multiple independent simulation runs for statistical validity

What genomic analysis approaches are most effective for studying MT-ND6 variants?

Comprehensive genomic analysis of MT-ND6 variants requires a structured bioinformatics pipeline:

Analysis StageRecommended ToolsKey Parameters
Quality ControlTrimgalore (v0.6.7+)Quality threshold ≥15, Length ≥50bp
AlignmentBWA-MEM (v0.7.17+)Reference: hg38 chrM
Variant CallingGATK HaplotypeCaller & Mutect2Combined approach for higher sensitivity
Variant AnnotationEnsemble VEP (v104+)Include rsID, gene effects, clinical significance
Heteroplasmy AnalysisCustom scriptsCalculate percentage of variant-containing reads
Structural PredictionAlphaFold, RoseTTAFoldFor novel variants without crystal structures
Conservation AnalysisPhyloP, GERP, multiple sequence alignmentAcross species comparisons

For mitochondrial variants specifically, heteroplasmy quantification is crucial, as disease manifestation often depends on the proportion of mutant mtDNA. Advanced approaches might include single-cell sequencing to assess heteroplasmy at the cellular level, providing insights into tissue-specific mutation distribution patterns.

What biochemical assays are most informative for assessing MT-ND6 mutation impacts on Complex I?

To comprehensively evaluate the impact of MT-ND6 mutations on Complex I function, researchers should employ a tiered approach:

  • Assembly assessment:

    • Blue Native PAGE with Coomassie staining to visualize intact complexes

    • Immunoblotting with antibodies targeting different Complex I subunits

    • In-gel activity assays using NADH and nitrotetrazolium blue

  • Protein expression analysis:

    • Western blotting with antibodies targeting different epitopes (N-terminal vs. C-terminal)

    • Pulse-chase experiments to assess protein stability

    • Mass spectrometry for precise quantification

  • Enzymatic activity measurements:

    • Spectrophotometric NADH oxidation assays

    • Oxygen consumption measurements using respirometry

    • ATP synthesis capacity in intact mitochondria

  • ROS production assessment:

    • Fluorescent probes (e.g., MitoSOX, H2DCFDA)

    • Electron paramagnetic resonance spectroscopy

    • Lipid peroxidation assays as indirect measures

These complementary approaches provide a comprehensive picture of how mutations affect not only protein structure but also the resulting functional consequences for mitochondrial energy production and cellular health.

How does heteroplasmy level affect the phenotypic expression of MT-ND6 mutations?

The relationship between MT-ND6 mutation heteroplasmy and phenotypic expression follows threshold effect principles:

  • Biochemical threshold: Studies have shown that heteroplasmic MT-ND6 mutations at approximately 60% can cause detectable Complex I defects , while homoplasmic mutations may have varying effects depending on the specific mutation.

  • Tissue-specific thresholds: Different tissues exhibit varying sensitivity to MT-ND6 mutations based on their energy demands:

    • High-energy tissues (brain, heart, muscle) typically show lower thresholds

    • Tissues with lower energy demands may tolerate higher heteroplasmy levels

  • Clinical correlation challenges: Research indicates that "mutant loads of m.14487T>C and disease phenotype are not closely correlated" , suggesting complex modifier effects.

  • Diagnostic implications: The lack of strict correlation between heteroplasmy and clinical presentation creates challenges for molecular diagnosis of MT-ND6-related diseases, potentially leading to "false negative diagnoses if other tissues are tested" .

These findings highlight the importance of comprehensive heteroplasmy analysis across multiple tissues when evaluating MT-ND6 mutations and suggest the involvement of nuclear genetic modifiers in determining disease expression.

What are the challenges in distinguishing pathogenic from non-pathogenic MT-ND6 variants?

Distinguishing pathogenic from benign MT-ND6 variants represents a significant challenge in mitochondrial genetics:

  • Functional validation requirements: Evidence suggests that some MT-ND6 mutations previously considered pathogenic, such as m.14487T>C, may be "insufficient to cause mitochondrial deficiency" without additional modifier genes .

  • Methodological approaches:

    • Cybrid studies comparing multiple heteroplasmy levels

    • In silico prediction algorithms specific for mtDNA variants

    • Conservation analysis across species

    • Family segregation studies where available

  • Integrated assessment criteria:

    • Biochemical impact on Complex I structure and function

    • Tissue-specific heteroplasmy distribution

    • Clinical correlation with established mitochondrial disease phenotypes

    • Absence in healthy control populations

  • Confounding factors:

    • Background mtDNA haplogroup effects

    • Nuclear genetic modifiers

    • Environmental influences on mitochondrial function

These challenges necessitate a comprehensive approach combining multiple lines of evidence before classifying an MT-ND6 variant as definitively pathogenic, with functional studies being particularly critical for accurate assessment.

How can researchers study the interaction between MT-ND6 and other Complex I subunits?

Investigating the interactions between MT-ND6 and other Complex I subunits requires specialized techniques:

  • Structural biology approaches:

    • Cryo-electron microscopy of intact Complex I

    • X-ray crystallography of subcomplexes

    • Crosslinking mass spectrometry to identify interaction interfaces

  • Protein-protein interaction methods:

    • Co-immunoprecipitation with MT-ND6-specific antibodies

    • Proximity labeling techniques (BioID, APEX)

    • Yeast two-hybrid using membrane protein adaptations

  • Computational methods:

    • Molecular dynamics simulations to assess dynamic interactions

    • Protein-protein docking

    • Coevolution analysis of interacting residues

  • Genetic approaches:

    • Suppressor mutation analysis

    • Site-directed mutagenesis of predicted interface residues

    • Genetic complementation studies

Understanding these interactions is particularly important given that "ND6 is a subunit of Complex I, located at the junction between the P and the Q module" , suggesting a critical role in complex assembly and function.

How does Ceratotherium simum MT-ND6 compare with MT-ND6 from other mammalian species?

Comparative analysis of MT-ND6 across mammalian species provides evolutionary and functional insights:

  • Sequence conservation patterns:

    • Core functional domains show high conservation

    • Species-specific variations often occur in less functionally constrained regions

    • Transmembrane domains typically show higher conservation than loop regions

  • Structural comparison approaches:

    • Multiple sequence alignments across diverse mammalian orders

    • 3D structural modeling to identify conserved interaction surfaces

    • Analysis of selection pressures using dN/dS ratios

  • Functional implications:

    • Research in model organisms suggests conservation of fundamental Complex I assembly mechanisms

    • Studies in Chaetomium thermophilum have revealed "the pivotal function of ND6 in creating the E-channel" , likely conserved in mammals

  • Evolutionary adaptations:

    • Species-specific adaptations may reflect metabolic requirements

    • Potential correlations with longevity, body size, or environmental niche

Researchers studying Ceratotherium simum MT-ND6 should consider these comparative aspects to better understand both conserved functions and species-specific adaptations.

What can we learn from studying MT-ND6 in endangered species like Ceratotherium simum?

Research on MT-ND6 in endangered species like the white rhinoceros offers unique scientific and conservation insights:

  • Conservation genetics applications:

    • Assessment of genetic diversity in mitochondrial genes

    • Identification of potentially deleterious mutations affecting fitness

    • Understanding maternal lineage patterns through mtDNA analysis

  • Comparative bioenergetics:

    • Species-specific adaptations in energy metabolism

    • Potential correlations with physiological traits (body size, longevity)

    • Insights into metabolic adaptations to environmental challenges

  • Reproductive technology implications:

    • MT-ND6 function could impact embryonic development and viability

    • Potential relevance for assisted reproductive technologies in conservation

    • Mitochondrial function assessment in preserved genetic material

  • Methodological considerations:

    • Limited sample availability necessitates non-invasive sampling approaches

    • Development of species-specific research tools and reagents

    • Ethical considerations in endangered species research

This research not only advances our understanding of fundamental mitochondrial biology but may also contribute to conservation efforts for this critically endangered species.

What are the most promising future research directions for MT-ND6 studies?

Several emerging research areas promise to advance our understanding of MT-ND6 function and pathology:

  • Single-cell approaches: Investigating cell-to-cell variation in MT-ND6 heteroplasmy and its functional consequences using single-cell sequencing and imaging technologies.

  • Gene therapy developments: Exploring mitochondrially targeted nucleases and base editors for correcting MT-ND6 mutations in affected tissues.

  • Systems biology integration: Combining transcriptomic, proteomic, and metabolomic analyses to build comprehensive models of how MT-ND6 mutations affect cellular networks .

  • Comparative genomics expansion: Extending studies across diverse species to better understand evolutionary constraints and adaptations in MT-ND6 function.

  • Structural biology advances: Utilizing improved cryo-EM technologies to obtain higher-resolution structures of Complex I with various MT-ND6 mutations.

These approaches, particularly when combined in integrative studies, will likely yield significant insights into both basic biology and potential therapeutic approaches for MT-ND6-related diseases.

How can researchers address current limitations in MT-ND6 research methodologies?

Current research faces several methodological challenges that require innovative solutions:

  • Heteroplasmy quantification accuracy:

    • Development of more sensitive techniques for low-level heteroplasmy detection

    • Standardization of heteroplasmy measurement protocols across laboratories

    • Implementation of digital PCR and third-generation sequencing for improved accuracy

  • Functional assessment standardization:

    • Establishment of reference ranges for Complex I activity measurements

    • Development of high-throughput screening approaches for mutation effects

    • Creation of publicly available datasets for computational model training

  • Tissue-specific effects:

    • Utilization of induced pluripotent stem cells to generate relevant cell types

    • Development of organoid models for tissue-specific studies

    • Implementation of in vivo imaging techniques for non-invasive assessment

  • Therapeutic development platforms:

    • Establishment of patient-derived cell lines with various MT-ND6 mutations

    • Development of high-content screening approaches for compound identification

    • Creation of appropriate animal models for preclinical testing

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.