Recombinant Cercocebus atys C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Expression

CCR5 is a seven-transmembrane G protein-coupled receptor (GPCR) composed of 352 amino acids with a molecular weight of ~40.6 kDa . Its domains include:

  • Extracellular N-terminus: Binds chemokines like CCL3, CCL4, and CCL5.

  • Transmembrane α-helices: Facilitate signal transduction.

  • Intracellular C-terminus: Mediates G-protein coupling and internalization .

The recombinant form of Cercocebus atys CCR5 is produced in E. coli with an N-terminal His tag for purification . Key specifications include:

ParameterDetail
SpeciesCercopithecus lhoesti (L'Hoest's monkey; taxonomic note below)
Protein LengthFull-length (1-352 amino acids)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Taxonomic Note: While labeled as Cercopithecus lhoesti in commercial sources , Cercocebus atys (sooty mangabey) CCR5 is distinct but shares evolutionary parallels, including common mutations like Δ24 .

Functional Role in Immunity and Viral Entry

CCR5 regulates immune cell migration (e.g., T cells, monocytes) via chemokine signaling . In mangabeys, it also serves as a coreceptor for SIV entry, though natural mutations alter this function:

Key Mutations and Viral Tropism

  • Δ24 Deletion: An in-frame 24-bp deletion in the fourth transmembrane region, found in 86.6% of red-capped mangabeys (Cercocebus torquatus), abolishes surface CCR5 expression and R5-tropic SIV entry .

  • CCR5Δ2: A frameshift mutation in sooty mangabeys (Cercocebus atys) causing loss of coreceptor function .

Despite these mutations, mangabeys infected with SIVsmm (sooty mangabey strain) exhibit robust viral replication via alternative coreceptors like CCR2b . Recombinant CCR5 enables mechanistic studies of these adaptations.

Coreceptor Studies

  • Viral Entry Assays: Recombinant CCR5 is used to test SIV/HIV entry inhibition. For example, Δ24 CCR5-transfected cells resist R5-tropic SIVmac and HIV-1 entry .

  • Ligand Binding: Evaluates interactions with chemokines (e.g., CCL3, CCL5) and viral glycoproteins (e.g., SIV gp120) .

Evolutionary Insights

  • The Δ24 mutation’s high frequency (86.6% in red-capped mangabeys vs. 4.1% in sooty mangabeys) suggests ancient origins (>10,000 years) .

  • Parallel evolution of CCR5-null alleles in humans (Δ32) and mangabeys highlights convergent selection pressures .

Comparative Analysis of CCR5 Mutations

SpeciesMutationCoreceptor Use by SIVPrevalenceFunctional Outcome
Red-capped mangabeyΔ24 CCR5CCR2b (R2b-tropic)86.6% allele frequency No surface expression; blocks R5-tropic viruses
Sooty mangabeyCCR5Δ2Alternative pathways26% allele frequency Loss of coreceptor function; robust SIV replication
HumanΔ32 CCR5N/A~1% (Europeans)Resistance to HIV-1 infection

Significance in Biomedical Research

  • HIV Resistance Models: Mangabeys with CCR5 mutations provide insights into viral adaptation and host resistance .

  • Therapeutic Development: Recombinant CCR5 aids in screening CCR5 antagonists (e.g., maraviroc) and gene-editing therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSP HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEASERASSVYTRSTGEQEISVGL
Uniprot No.

Target Background

Function
A receptor for various inflammatory CC-chemokines, including CCL3/MIP-1α, CCL4/MIP-1β, and RANTES. It transduces signals by increasing intracellular calcium ion levels. CCR5 may regulate granulocytic lineage proliferation or differentiation and plays a role in T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of Cercocebus atys CCR5?

Cercocebus atys CCR5 is a seven-transmembrane G protein-coupled receptor protein belonging to the beta chemokine receptor family. The protein consists of 352 amino acids with an approximate molecular weight of 40.5 kDa, structurally similar to human CCR5 . The receptor contains four extracellular domains, seven transmembrane domains, and four intracellular domains. Unlike certain other primate CCR5 variants, such as the red-capped mangabey CCR5 which frequently contains a 24-bp deletion (Δ24), the sooty mangabey CCR5 typically maintains a complete sequence in the fourth transmembrane region . This structural conservation is significant for comparative studies examining the evolutionary adaptations of CCR5 across primate species.

How does CCR5 expression differ between Cercocebus atys and non-natural SIV hosts?

Sooty mangabeys (Cercocebus atys) express remarkably low levels of CCR5 on CD4+ T cells compared to non-natural SIV hosts. Specifically:

SpeciesAverage CCR5+ CD4+ T cells (Blood)Average CCR5+ CD4+ T cells (Lymph Nodes)Average CCR5+ CD4+ T cells (GI Tract)
Sooty Mangabeys1-4%2-5%1.2%
Rhesus Macaques10-30%20-40%>50%
Humans15-25%20-30%40-60%
Baboons10-20%15-35%54%

How do functional assays differentiate between wild-type and variant Cercocebus atys CCR5?

Functional assays for differentiating wild-type and variant CCR5 from Cercocebus atys involve multiple methodological approaches:

Viral Entry Assays: Cells expressing recombinant Cercocebus atys CCR5 variants can be tested for their ability to support entry of R5-tropic SIV or HIV strains using luciferase reporter viruses. Typically, 3×10⁴ cells expressing the receptor variant are seeded in 24-well plates and infected with luciferase reporter virus (20 ng p24 or p27) . After incubation and appropriate culture periods, cell lysates are analyzed for luciferase activity, quantifying the efficiency of viral entry.

Calcium Flux Assays: To assess signal transduction capabilities, cells expressing CCR5 variants are loaded with calcium-sensitive fluorescent dyes and stimulated with CCR5 ligands (MIP-1α, MIP-1β, RANTES). Changes in intracellular calcium levels are measured using flow cytometry or fluorescence plate readers, providing data on receptor functionality.

Chemotaxis Assays: Migration of cells expressing different CCR5 variants in response to chemokine gradients can be measured using transwell migration chambers. This methodology reveals functional differences in chemotactic responses mediated by different CCR5 variants.

The Δ24 CCR5 variant found in mangabeys has been demonstrated to be inactive in signal transduction mediated by β-chemokines and unable to support entry of R5-tropic SIV strains .

What methodologies are optimal for quantifying CCR5 expression in Cercocebus atys immune cells?

Optimal quantification of CCR5 expression in sooty mangabey immune cells requires specific methodological considerations:

Flow Cytometry: Multi-parameter flow cytometry using anti-CCR5 antibodies (often cross-reactive with human CCR5) combined with lineage markers (CD4, CD8, CD14) provides quantitative data on receptor expression. When analyzing CCR5 expression on CD4+ T cells, it's critical to use antibody clones validated for cross-reactivity with Cercocebus atys CCR5 . Controls using CD8+ T cells, which express normal levels of CCR5 in sooty mangabeys, help verify antibody specificity.

Quantitative RT-PCR: For transcriptional analysis, species-specific primers targeting conserved regions of the CCR5 gene should be designed. Reference genes must be validated specifically for sooty mangabey cells to ensure accurate normalization.

Immunohistochemistry: For tissue-specific expression analysis, tissues should be fixed in paraformaldehyde, embedded, and sectioned. Double staining with cell lineage markers (CD4, CD8, CD68) and CCR5 antibodies allows visualization of receptor expression in anatomical context.

For MALT-associated CD4+ T cells, which show particularly low CCR5 expression (approximately 1.2%) in sooty mangabeys, isolation protocols must be optimized to prevent selective loss of specific T cell subsets .

How can Cercocebus atys CCR5 mutants be engineered to study structure-function relationships?

Engineering Cercocebus atys CCR5 mutants requires systematic approaches:

Site-Directed Mutagenesis: Specific amino acid residues can be altered using PCR-based site-directed mutagenesis. Target residues should include those in the N-terminus and second extracellular loop that interact with chemokines and HIV/SIV envelope proteins. Mutations mimicking naturally occurring variations (like the Δ24 deletion) can provide insights into evolutionary adaptations.

Domain Swapping: Chimeric receptors containing domains from sooty mangabey CCR5 and other species (human, macaque) can be created using overlap extension PCR. These constructs help identify domains responsible for species-specific functional differences.

CRISPR/Cas9 Editing: For studying CCR5 function in primary sooty mangabey cells, CRISPR/Cas9 can be employed, though this requires optimization of transfection protocols for primary mangabey cells and design of guide RNAs specific to the sooty mangabey CCR5 sequence.

Successful expression of engineered constructs should be verified through surface staining, Western blotting, and functional assays before conducting comparative studies with wild-type receptors.

How should experiments be designed to compare CCR5 function between natural and non-natural SIV hosts?

Comparative studies of CCR5 function between natural hosts (like sooty mangabeys) and non-natural hosts require carefully controlled experimental designs:

Matched Sampling: Tissues from multiple anatomical sites (blood, lymph nodes, mucosal tissues) should be collected from age and sex-matched individuals from both species groups. For sooty mangabeys, sampling should include peripheral blood, lymph nodes, and rectal biopsies for MALT-associated cells .

Standardized Isolation Protocols: Consistent cell isolation techniques must be applied across species to avoid technique-dependent variations. For example, when isolating mucosal T cells, identical enzymatic digestion protocols and gradient separation methods should be used.

Multi-Parameter Phenotyping: Beyond CCR5 expression, cells should be characterized for activation markers (CD69, HLA-DR), memory phenotypes (CD45RA, CCR7), and proliferation status (Ki-67) to determine whether differences in CCR5 expression correlate with other immunological parameters.

Ex Vivo Infection Models: Isolated CD4+ T cells from both species can be infected with the same SIV isolates under identical conditions to assess differences in viral replication kinetics, cell death, and immune activation.

What experimental protocols are recommended for studying ligand binding kinetics of Cercocebus atys CCR5?

For studying ligand binding kinetics of sooty mangabey CCR5:

Radioligand Binding Assays: Cells expressing recombinant Cercocebus atys CCR5 should be incubated with 125I-labeled chemokines (MIP-1α, MIP-1β, RANTES) at varying concentrations. Competitive binding assays with unlabeled ligands can determine binding affinities and receptor densities.

Surface Plasmon Resonance (SPR): Purified recombinant CCR5 can be immobilized on sensor chips, and binding kinetics of flowing ligands measured in real-time. This allows determination of association (kon) and dissociation (koff) rate constants.

BRET/FRET Assays: To study receptor conformational changes upon ligand binding, biosensors based on bioluminescence/fluorescence resonance energy transfer can be employed. These require fusion of CCR5 with appropriate donor/acceptor molecules and expression in mammalian cell lines.

Data analysis should include Scatchard plots for radioligand binding and appropriate kinetic models for SPR data to extract binding parameters. Comparisons between sooty mangabey and human CCR5 under identical conditions will highlight species-specific differences in ligand recognition.

How can Cercocebus atys CCR5 research inform HIV therapeutic development?

Research on sooty mangabey CCR5 offers several pathways to inform HIV therapeutic development:

CCR5 Antagonist Optimization: Comparative binding studies of existing CCR5 antagonists (maraviroc, vicriviroc) to human and sooty mangabey CCR5 can identify structural features that enhance receptor blockade without disrupting natural chemokine signaling.

Gene Therapy Approaches: The naturally low expression of CCR5 on sooty mangabey CD4+ T cells provides a model for gene-editing approaches in humans. Studying the transcriptional regulation of mangabey CCR5 could reveal targets for reducing human CCR5 expression to levels that restrict HIV infection while maintaining immune function.

Novel Target Identification: The pathways maintaining low CCR5 expression in sooty mangabeys may involve species-specific transcription factors or post-transcriptional regulators that could serve as therapeutic targets. Comparative transcriptomic and epigenetic analyses between human and mangabey CD4+ T cells can identify these regulatory differences.

Immunomodulatory Strategies: Understanding how sooty mangabeys maintain normal immune function despite low CCR5 expression may guide development of immunomodulatory therapies that reduce CCR5-mediated inflammation without compromising immunity to pathogens.

What are the key considerations when designing expression systems for Cercocebus atys CCR5?

When designing expression systems for sooty mangabey CCR5:

Codon Optimization: The CCR5 coding sequence should be codon-optimized for the intended expression system (mammalian, insect, or bacterial cells) to enhance protein yield. For mammalian expression, human codon usage typically works well for sooty mangabey sequences.

Signal Sequence Selection: For proper membrane localization, an appropriate signal sequence should be included. While the native mangabey signal sequence can be used, the human CD8α leader sequence often enhances surface expression in heterologous systems.

Expression Vector Selection: For functional studies, vectors allowing stable integration (like pBabe with puromycin selection ) provide more consistent expression than transient systems. For high-yield production, inducible systems like tetracycline-regulated promoters help manage potential toxicity of overexpressed GPCRs.

Post-translational Modifications: Expression systems must support appropriate post-translational modifications, particularly N-linked glycosylation of the N-terminus. For this reason, mammalian cell lines (HEK293, CHO) are generally preferred over bacterial systems.

Verification Methods: Expression should be verified by multiple methods including flow cytometry with anti-CCR5 antibodies, Western blotting, and functional assays (calcium flux, chemotaxis) to ensure the recombinant receptor maintains native properties.

How can researchers address cross-reactivity issues when studying Cercocebus atys CCR5?

Cross-reactivity issues in sooty mangabey CCR5 research can be addressed through:

Antibody Validation: When using anti-CCR5 antibodies developed against human CCR5, validation should include positive controls (human samples) and comparative staining of CD8+ T cells from the same mangabey samples, which express normal levels of CCR5 . This controls for potential lack of cross-reactivity.

Multi-epitope Targeting: Using multiple antibodies targeting different CCR5 epitopes provides more reliable detection. If all antibodies show consistently low CCR5 expression on mangabey CD4+ T cells while detecting normal expression on CD8+ T cells, this confirms the finding is not due to poor cross-reactivity.

Genetic Confirmation: RT-PCR quantification of CCR5 mRNA using species-specific primers can confirm whether low protein expression corresponds to reduced transcription or post-transcriptional regulation.

Functional Assays: Beyond antibody-based detection, functional assays measuring responses to CCR5 ligands (calcium flux, chemotaxis) provide antibody-independent confirmation of receptor expression levels.

What troubleshooting approaches are recommended for SIV infection studies using Cercocebus atys CCR5?

When troubleshooting SIV infection studies involving sooty mangabey CCR5:

Coreceptor Verification: Before infection experiments, verify coreceptor usage of your SIV strain using cells expressing only specific coreceptors. Some SIV strains, like SIVrcm from red-capped mangabeys, have adapted to use CCR2b rather than CCR5 , which could confound results.

Cell Line Controls: Include control cell lines with known CCR5 expression levels (human, macaque) alongside mangabey-derived cells to establish baseline infection parameters for your viral stock.

Viral Stock Characterization: Thoroughly characterize your viral stock by sequencing the envelope region to confirm expected tropism and testing on cells expressing different coreceptors to verify entry pathways.

Multiplicity of Infection (MOI) Optimization: Due to low CCR5 expression on mangabey CD4+ T cells, higher MOIs may be required to achieve detectable infection. Titration experiments should establish appropriate viral concentrations.

Alternative Detection Methods: If standard p24/p27 ELISA assays yield inconsistent results, consider more sensitive methods like digital droplet PCR for viral DNA or RNA to detect low-level infection.

If infection fails despite controls suggesting viable virus, consider testing for cryptic resistance factors beyond CCR5 expression that might restrict viral replication post-entry.

How should researchers interpret CCR5 expression differences between tissue compartments in Cercocebus atys?

Interpreting CCR5 expression differences across tissue compartments in sooty mangabeys requires careful consideration:

Baseline Comparison Framework: For each tissue site (blood, lymph node, mucosa), compare CCR5 expression levels on CD4+ versus CD8+ T cells within the same animal to establish a baseline ratio. In sooty mangabeys, the CD4:CD8 ratio of CCR5 expression is significantly lower than in non-natural hosts across all tissues .

Tissue-Specific Normalization: When comparing across tissues, normalize for the different baseline activation states of T cells in each compartment. For example, mucosal tissues naturally contain higher percentages of effector memory T cells, which typically express higher CCR5 levels.

Memory Subset Analysis: Stratify analysis by naive (CD45RA+CCR7+), central memory (CD45RA-CCR7+), and effector memory (CD45RA-CCR7-) T cell subsets, as CCR5 expression varies substantially between these populations. This reveals whether tissue differences represent altered subset distribution or true differences in CCR5 regulation.

Functional Correlation: Correlate CCR5 expression with functional parameters (proliferation, cytokine production) in each tissue to determine the immunological significance of expression differences.

In sooty mangabeys, the remarkably low CCR5 expression on MALT-associated CD4+ T cells (approximately 1.2%) compared to non-natural hosts (>50%) suggests tissue-specific mechanisms downregulating CCR5 in mucosal compartments .

What statistical approaches are most appropriate for analyzing Cercocebus atys CCR5 expression data?

For statistical analysis of sooty mangabey CCR5 expression data:

Non-parametric Methods: Due to typically non-normal distribution of CCR5 expression levels, non-parametric tests (Mann-Whitney, Kruskal-Wallis) are often more appropriate than parametric alternatives.

Paired Analyses: When comparing different cell populations from the same animal (CD4+ vs. CD8+, blood vs. tissue), paired statistical tests increase power by controlling for inter-individual variation.

Mixed-effects Models: For longitudinal studies tracking CCR5 expression over time, mixed-effects models accounting for repeated measures within individuals provide more accurate estimates of temporal trends.

Sample Size Considerations: Power calculations should account for the high variability typically observed in primate studies. For detecting moderate effect sizes (d=0.5) between species with 80% power, approximately 12-15 animals per group are typically needed.

Multiple Testing Correction: When analyzing CCR5 expression across multiple cell types and tissues, appropriate correction for multiple comparisons (Bonferroni or false discovery rate) must be applied to prevent type I errors.

How do findings from Cercocebus atys CCR5 studies translate to human HIV research contexts?

Translating findings from sooty mangabey CCR5 studies to human HIV research requires careful consideration of several factors:

Evolutionary Context: Sooty mangabeys have coevolved with SIV for thousands of years, developing adaptations like reduced CCR5 expression on CD4+ T cells . Humans, as a more recent host for HIV, lack these adaptations, making direct translation challenging.

Mechanistic Validation: When a protective mechanism is identified in mangabeys (e.g., low CCR5 expression), its potential benefit in humans should be validated through in vitro systems using human cells before clinical application.

Partial Implementation Framework: Rather than attempting to fully replicate the mangabey phenotype in humans, research should focus on specific aspects that could be therapeutically beneficial. For example, while achieving the extremely low CCR5 levels seen in mangabeys might be unattainable, modest reduction through pharmaceutical or gene therapy approaches might confer partial protection.

Therapeutic Index Consideration: Sooty mangabeys maintain immune competence despite low CCR5 expression, suggesting a therapeutic window exists where CCR5 reduction benefits outweigh potential immunological costs. Human therapeutic approaches must carefully define this window.

Combinatorial Approaches: Sooty mangabeys employ multiple mechanisms to avoid pathogenesis (low CCR5, limited immune activation, preserved CD4+ T cell homeostasis). Successful human therapeutic strategies may need to target multiple pathways simultaneously rather than focusing solely on CCR5.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.