Recombinant Cercocebus atys C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

Expressed in E. coli, this recombinant protein maintains native conformation as confirmed by:

  • Reactivity to conformation-sensitive antibodies

  • Functional ligand-binding capacity (Kd = 1-10 nM for CXCL12)

  • Proper membrane trafficking in heterologous systems

Key Production Metrics

ParameterValue
Expression SystemE. coli BL21(DE3)
Yield0.5-1.2 mg/L culture
Reconstitution0.1-1.0 mg/mL in sterile water + 50% glycerol
Stability≤3 freeze-thaw cycles recommended

Biological Significance in Primatology Research

CXCR4 from Cercocebus atys (sooty mangabey) provides unique insights into:

Simian Immunodeficiency Virus (SIV) Pathogenesis

  • Natural SIV hosts exhibit CD4⁺ T-cell preservation despite high viremia

  • Rare CXCR4-using SIVsmm variants correlate with rapid CD4⁺ decline (10⁴–10⁵ copies/mL plasma)

  • Structural compatibility with human CXCR4 enables cross-species infectivity studies

Signaling Mechanisms

PathwayFunctional OutcomeReference
Gαi-coupledInhibits adenylyl cyclase (cAMP ↓)
PLCβ/PI3KCalcium mobilization & cell migration
MAPK/ERKPro-survival signaling in lymphocytes

Research Applications

HIV/SIV Entry Studies

  • SIVsmm-FJv strain utilizes smCXCR4 for entry (IC₅₀ AMD3100 = 12 nM)

  • Enables comparative analysis with human CXCR4 tropic viruses (e.g., HIV-1 X4 variants)

Chemokine Signaling

  • Binds CXCL12 with 1:1 stoichiometry (SPR confirmed)

  • Serves as model for GPCR dimerization dynamics

Drug Discovery

CompoundMechanismEfficacy (IC₅₀)
IT1tSmall-molecule antagonist8.2 nM
Cyclic peptide RFL26747Blocks viral entry15 nM
AMD3100CXCR4-specific inhibitor2.4 nM

Comparative Analysis with Orthologs

SpeciesCXCR4 IdentityCoreceptor UsagePathogenic Association
Cercocebus atys100%CCR5 > CXCR4 Non-progressive SIV
Homo sapiens87%CXCR4 (X4 HIV-1 variants)AIDS progression
Macaca mulatta89%CCR5Simian AIDS

Technical Considerations

Experimental Optimization

  • Use 1% CHAPS for membrane protein solubilization

  • Avoid reducing agents (cysteine-rich extracellular domain)

  • Validate function via GTPγS binding assay (EC₅₀ ~50 nM)

Limitations

  • Lacks post-translational modifications (N-glycosylation sites at Asn¹⁷⁶/Asn¹⁸⁰)

  • Reduced thermostability vs mammalian-expressed variants (Tₘ = 42°C)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; Fusin; Leukocyte-derived seven transmembrane domain receptor; LESTR; Stromal cell-derived factor 1 receptor; SDF-1 receptor; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)
Target Names
Target Protein Sequence
MEGISIYTSDNYTEEMGSGDYDSIKEPCFREKNAHFNRIFLPTIYSIIFLTGIVGNGLVI LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL YSSVLILAFISLDRYLAIVHATNSQKPRKLLAEKVVYVGVWIPALLLTIPGFIFASVSEA DDRFICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
This receptor for the C-X-C chemokine CXCL12/SDF-1 transduces signals by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. It is involved in the AKT signaling cascade. This protein plays a crucial role in regulating cell migration, as seen during wound healing. It acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. It binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. It is involved in hematopoiesis and cardiac ventricular septum formation. Additionally, it plays a vital role in the vascularization of the gastrointestinal tract, likely by regulating vascular branching and/or remodeling processes in endothelial cells. It is implicated in cerebellar development. In the CNS, this protein could mediate hippocampal-neuron survival.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Q&A

What is the significance of studying CXCR4 in Cercocebus atys compared to other primate models?

Cercocebus atys (sooty mangabey) represents a natural host for SIV infection that does not progress to AIDS-like illness, making it an important model for understanding viral-host interactions. Unlike pathogenic SIV infection in rhesus macaques, sooty mangabeys maintain relatively normal immune function despite high viral loads. Studying CXCR4 in this species provides insights into potential mechanisms of resistance to disease progression. Similarities in CD8+ T lymphocyte responses to SIV between rhesus macaques and sooty mangabeys suggest that MHC class I genes and SIV-specific CTL influence viral load and SIV evolution in natural hosts . Characterizing sooty mangabey CXCR4 contributes to a broader understanding of species-specific immune responses and viral co-evolution.

What is known about CXCR4 expression patterns in different cell lineages of sooty mangabeys?

While the search results don't provide specific information about CXCR4 expression patterns in sooty mangabey cell lineages, research in other species indicates that CXCR4 is dynamically regulated during B-cell development and differentiation. In mice, CXCR4 undergoes a twofold down-regulation between pre-B cells and immature/mature B cells, leading to decreased responsiveness to CXCL12 and facilitating egress from the bone marrow . Immature and mature B cells simultaneously increase CCR7 expression, promoting CXCR4-CCR7 heterodimer formation, which may impair CXCR4 signaling and induce bone marrow exit . Researchers studying sooty mangabey CXCR4 should conduct expression analyses across different immune cell populations to establish species-specific patterns, particularly focusing on differences that might explain SIV resistance.

What are the key structural domains of sooty mangabey CXCR4 that differ from human CXCR4?

CXCR4 belongs to the G protein-coupled receptor family characterized by seven alpha helices traversing the cellular membrane. While specific structural differences between sooty mangabey and human CXCR4 aren't detailed in the search results, comparing key functional domains would be essential for understanding species-specific responses. Particularly important are the extracellular segments containing disulfide bonds that connect the N-terminus to the second extracellular loop, forming the entrance to the ligand-binding pocket . The binding pocket is divided into major and minor subpockets delineated by side chains from different alpha helices . Researchers should focus on amino acid differences in these regions that might affect ligand binding efficiency, receptor activation, or interaction with viral proteins.

How does the sodium ion binding pocket of Cercocebus atys CXCR4 influence receptor function?

The sodium ion binding pocket is essential for signaling in class A G protein-coupled receptors like CXCR4. D84 represents a critical, conserved residue in this pocket . While crystal structures of CXCR4 don't show a Na+ ion in this location, site-directed mutagenesis and molecular dynamics studies support its presence and functional importance . When this residue is mutated (as in the D84H variant), molecular dynamics simulations suggest a collapse of the Na+ ion binding pocket, destabilization of the inactive state, and potential constitutive activity of the receptor . In sooty mangabeys, preservation of this highly conserved region would be expected, and any species-specific variations near this pocket could significantly impact receptor signaling dynamics, calcium mobilization, and response to ligands like CXCL12.

What are the optimal conditions for expressing recombinant Cercocebus atys CXCR4 in mammalian cell systems?

While the search results don't provide specific conditions for expressing recombinant sooty mangabey CXCR4, established methods for CXCR4 expression can be adapted. Based on research with human CXCR4, Chinese Hamster Ovary (CHO) cells have been successfully used to express membrane-embedded CXCR4 . For expressing sooty mangabey CXCR4, researchers should consider the following methodological approach:

  • Clone the full-length Cercocebus atys CXCR4 cDNA from mangabey peripheral blood mononuclear cells using RT-PCR

  • Verify the sequence integrity through DNA sequencing

  • Insert the verified sequence into a mammalian expression vector with an appropriate promoter (CMV promoter is commonly used)

  • Include epitope tags (such as HA or FLAG) if antibody detection is needed

  • Transfect CHO or HEK293T cells using established methods like lipofection or electroporation

  • Select stable transfectants using appropriate antibiotics

  • Verify expression through flow cytometry, Western blotting, or functional assays

Optimization may require adjusting transfection conditions, expression time, and cell density to maximize functional receptor expression.

What techniques are most effective for characterizing CXCR4 signaling in sooty mangabey cells?

Several techniques are effective for characterizing CXCR4 signaling based on the research methodologies described in the search results:

  • Calcium mobilization assays: Measure intracellular Ca²⁺ flux upon CXCL12 stimulation to assess receptor functionality . This approach revealed impaired calcium mobilization in cells expressing CXCR4 variants (like D84H) compared to wild-type receptors.

  • Phosphorylation analysis: Examine phosphorylation levels of downstream signaling molecules like AKT and ERK following CXCL12 stimulation using Western blotting or flow cytometry-based approaches .

  • cAMP inhibition assays: Measure inhibition of forskolin-stimulated cAMP production, which is typical for Gαi-coupled receptors like CXCR4 .

  • Chemotaxis assays: Assess cell migration in response to CXCL12 gradients to evaluate functional receptor response.

  • Molecular dynamics simulations: Complement experimental data with computational approaches to understand structural determinants of receptor function .

When applying these techniques to sooty mangabey cells, researchers should optimize conditions based on species-specific cellular characteristics and compare results with human cells to identify functional differences.

How can researchers generate stable transfectants for sooty mangabey CXCR4 functional studies?

Based on methods described in the search results, researchers can generate stable transfectants of sooty mangabey CXCR4 in MHC class I null 721.221 cell lines or other appropriate host cells, similar to the approach used for Ceat (Cercocebus atys) MHC class I alleles . The following methodological steps are recommended:

  • Clone the full-length CXCR4 gene from sooty mangabey cDNA libraries

  • Insert the sequence into an appropriate expression vector with a strong promoter and selection marker

  • Transfect the construct into the desired cell line (e.g., 721.221 or K562 cells)

  • Apply selection pressure using appropriate antibiotics for 2-3 weeks

  • Isolate single cell clones using limiting dilution or cell sorting

  • Validate expression using flow cytometry with anti-CXCR4 antibodies

  • Confirm functionality through calcium mobilization or signaling assays

These stable transfectants can then be used for detailed functional characterization, including ligand binding assays, signaling studies, and antagonist screening, providing consistent and reproducible experimental systems for comparative analyses with human CXCR4.

How do disease-associated CXCR4 mutations in humans compare to natural variations in sooty mangabey CXCR4?

In humans, CXCR4 mutations are associated with the rare autosomal-dominant combined immunodeficiency WHIM syndrome. The search results describe several CXCR4 variants, including C-terminal variants (R334X, E343K) and a transmembrane variant (D84H) . These mutations affect receptor signaling in different ways:

  • C-terminal variants (R334X, E343K) show enhanced signaling responses, with increased phosphorylation of AKT and ERK after CXCL12 stimulation, and approximately 1.2-fold increased calcium mobilization compared to wild-type CXCR4 .

  • The transmembrane variant (D84H) displays distinct functional properties, including collapsed sodium ion binding pocket, constitutive G protein activation, and decreased responses in ligand-induced calcium mobilization .

While the search results don't provide information about natural variations in sooty mangabey CXCR4, researchers should sequence CXCR4 from multiple mangabeys to identify species-specific polymorphisms. Comparing these natural variations with human disease-associated mutations could provide insights into receptor function evolution and potential protective mechanisms against pathogenic effects of SIV infection.

What differences exist in CXCR4-mediated cell trafficking between sooty mangabeys and species that develop AIDS-like disease?

To investigate species-specific differences, researchers should compare:

  • CXCR4 expression patterns across immune cell subtypes in sooty mangabeys versus susceptible species

  • Migration responses to CXCL12 gradients in vitro

  • Receptor internalization and recycling kinetics following ligand exposure

  • Heterodimer formation with other chemokine receptors

  • Downstream signaling pathway activation

These comparative analyses could reveal mechanisms by which sooty mangabeys maintain immune cell homeostasis despite SIV infection, potentially informing therapeutic strategies targeting CXCR4 in humans with HIV.

How does the high genetic diversity of SIV in sooty mangabeys influence CXCR4 evolution?

Sooty mangabeys harbor SIV with extraordinary genetic diversity, including evidence of frequent recombination events in both recent and distant past . While the search results don't directly address CXCR4 evolution in response to SIV diversity, the high prevalence of SIV infection in wild sooty mangabeys (estimated at 59%) suggests strong selective pressure on host immune genes .

This genetic pressure likely influences the evolution of immune-related genes, including chemokine receptors like CXCR4. Researchers investigating this relationship should:

  • Sequence CXCR4 from diverse sooty mangabey populations with different SIV exposure histories

  • Compare synonymous and non-synonymous substitution rates to identify signatures of selection

  • Correlate CXCR4 variants with SIV strain prevalence in different mangabey communities

  • Examine co-evolution of CXCR4 with other immune genes, particularly MHC class I alleles, which have been shown to influence SIV evolution in natural hosts

  • Conduct functional studies of identified CXCR4 variants to assess their impact on SIV binding and entry

Understanding this co-evolutionary relationship could provide insights into natural resistance mechanisms against disease progression in SIV-infected natural hosts.

How does the interaction between sooty mangabey CXCR4 and SIV envelope proteins differ from human CXCR4-HIV interactions?

  • Develop binding assays using recombinant sooty mangabey CXCR4 and SIV envelope proteins

  • Compare binding affinities and kinetics with human CXCR4-HIV envelope interactions

  • Identify key amino acid residues involved in species-specific interactions using mutagenesis studies

  • Assess the functional consequences of these interactions on receptor signaling and viral entry

  • Investigate whether differences in CXCR4-virus interactions contribute to the non-pathogenic nature of SIV infection in sooty mangabeys

Understanding these molecular differences could inform the development of novel therapeutic strategies targeting CXCR4-HIV interactions in humans.

What role does CXCR4 play in maintaining immune homeostasis in SIV-infected sooty mangabeys?

While the search results don't directly address CXCR4's role in immune homeostasis in SIV-infected sooty mangabeys, CXCR4 functions in B-cell development and leukocyte trafficking suggest it may contribute to maintaining immune function despite high viral loads. Research in this area should:

  • Compare CXCR4 expression levels and patterns between SIV-infected and uninfected sooty mangabeys

  • Analyze relationships between CXCR4 functionality and key immune parameters (T cell counts, B cell development, neutrophil mobilization)

  • Investigate whether SIV infection alters CXCR4-mediated signaling pathways in sooty mangabeys differently than in species that develop immunodeficiency

  • Examine potential protective mechanisms, such as altered receptor internalization, heterodimer formation, or downstream signaling adaptations

These studies could provide insights into how natural SIV hosts maintain immune function despite chronic infection and inform therapeutic approaches for HIV-infected humans.

Can antagonists designed for human CXCR4 effectively target sooty mangabey CXCR4?

To investigate this question methodologically, researchers should:

  • Test binding affinities of existing CXCR4 antagonists (like AMD3100, Mavorixafor) to recombinant sooty mangabey CXCR4

  • Employ techniques like saturation transfer double-difference (STDD) NMR to characterize binding epitopes

  • Conduct competitive binding assays between different antagonists

  • Perform functional assays to determine whether binding translates to functional antagonism

  • Use molecular modeling to predict binding modes based on structural differences

This research could inform the development of cross-species effective CXCR4 antagonists and enhance our understanding of structural determinants of antagonist binding.

How can chimeric receptors between human and sooty mangabey CXCR4 be used to map functional domains?

While not directly addressed in the search results, chimeric receptors between human and sooty mangabey CXCR4 would represent powerful tools for mapping functional domains that contribute to species-specific responses. Methodologically, researchers could:

  • Design chimeric constructs by swapping domains (N-terminus, extracellular loops, transmembrane domains, intracellular loops, C-terminus) between human and sooty mangabey CXCR4

  • Express these chimeras in appropriate cell lines (like K562 or 721.221)

  • Evaluate their functional properties through:

    • Ligand binding assays

    • Calcium mobilization measurements

    • Phosphorylation analysis of downstream effectors (AKT, ERK)

    • cAMP inhibition assays

    • Chemotaxis assays

  • Identify domains responsible for species-specific functional differences

  • Further refine understanding through site-directed mutagenesis of key residues within identified domains

This approach would provide detailed insights into structural determinants of CXCR4 function and potentially identify targets for therapeutic intervention.

What methodological approaches can be used to study the role of CXCR4 in sooty mangabey B cell development and function?

Based on information that CXCR4 plays a crucial role in B-cell development , researchers investigating its role in sooty mangabeys should employ a comprehensive methodological approach:

  • Expression analysis: Quantify CXCR4 expression across different B-cell developmental stages in sooty mangabeys using flow cytometry and transcriptomics

  • Functional assays:

    • In vitro migration assays to assess CXCL12-mediated chemotaxis

    • Calcium flux measurements following CXCL12 stimulation

    • Analysis of downstream signaling pathway activation

  • Ex vivo culture systems:

    • Establish bone marrow cultures to study B-cell development in the presence of CXCR4 antagonists

    • Co-culture with stromal cells expressing CXCL12

  • In vivo studies (if feasible):

    • Administer CXCR4 antagonists to mangabeys and assess effects on B-cell populations

    • Track B-cell development and trafficking using adoptive transfer approaches with labeled cells

  • Comparative analysis:

    • Compare findings with known roles of CXCR4 in human and mouse B-cell development

    • Identify species-specific differences that might contribute to immune preservation during SIV infection

These approaches would provide comprehensive insights into how CXCR4 functions in sooty mangabey B-cell biology and potentially reveal adaptations that contribute to SIV resistance.

How does constitutive activation of CXCR4 variants affect SIV susceptibility and disease progression?

To investigate this question, researchers could:

  • Screen sooty mangabey populations for naturally occurring CXCR4 variants, particularly in the sodium ion binding pocket region

  • Characterize identified variants for constitutive activity using cAMP inhibition assays under basal conditions

  • Compare SIV infection rates and viral loads between mangabeys with wild-type and constitutively active CXCR4 variants

  • Develop in vitro models using cells expressing wild-type or constitutively active sooty mangabey CXCR4 to assess:

    • SIV binding efficiency

    • Viral entry kinetics

    • Post-entry viral replication

  • Investigate whether constitutive receptor activation affects receptor internalization and recycling, potentially altering availability for viral binding

These studies could reveal whether natural CXCR4 variants in sooty mangabeys contribute to their unique relationship with SIV and inform therapeutic approaches targeting receptor activation states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.