Recombinant Cercocebus galeritus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical protein encoded by the mitochondrial DNA in many organisms. In the context of Cercocebus galeritus, also known as the Tana River mangabey, MT-CO2 plays a vital role in cellular respiration and energy production . Recombinant MT-CO2 refers to the protein produced using recombinant DNA technology, which involves introducing the gene encoding MT-CO2 into a host organism (e.g., bacteria, yeast, or mammalian cells) to produce large quantities of the protein for research or diagnostic purposes.

Background on Cercocebus galeritus

Cercocebus galeritus is an endangered primate species inhabiting the Tana River basin in Kenya . The Tana River mangabey faces numerous threats, including habitat loss due to deforestation, agriculture, and altered flooding regimes . Conservation efforts are crucial to protect this species and its unique genetic diversity .

Role of MT-CO2 in Phylogenetic Studies

Mitochondrial genes, including MT-CO2, are commonly used in phylogenetic studies to understand the evolutionary relationships between different species or populations . The MT-CO2 gene is useful because it evolves at a rate suitable for resolving relationships between closely related species. Phylogenetic analyses using MT-CO2 sequences have helped clarify the relationships between Cercocebus galeritus and other mangabey species, as well as their divergence times .

Genetic Diversity and Conservation

Studies of genetic diversity within Cercocebus galeritus populations are essential for effective conservation management . Assessing genetic variation using MT-CO2 and other genetic markers can help identify distinct populations or evolutionarily significant units that require specific conservation strategies. Preserving genetic diversity is crucial for the long-term survival and adaptability of the species.

Applications of Recombinant MT-CO2

Recombinant MT-CO2 protein can be used in various applications:

  • ELISA assays: Recombinant MT-CO2 can be used as an antigen in enzyme-linked immunosorbent assays (ELISA) to detect and quantify antibodies against Cercocebus galeritus MT-CO2 in biological samples . This can be useful for studying the immune response of mangabeys to certain diseases or pathogens.

  • Structural studies: Recombinant MT-CO2 can be produced and purified in large quantities for structural studies, such as X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy. These studies can provide insights into the protein's three-dimensional structure and its functional mechanisms.

  • Functional assays: Recombinant MT-CO2 can be used in in vitro functional assays to study its enzymatic activity and interactions with other proteins. This can help elucidate the role of MT-CO2 in cellular respiration and identify potential drug targets.

Conservation Implications

Understanding the genetic diversity, evolutionary history, and ecological correlates of abundance in Cercocebus galeritus is crucial for effective conservation. Habitat preservation, reduction of human-wildlife conflict, and community engagement are essential strategies for protecting this endangered primate and its habitat .

Further Research

Further research is needed to fully characterize the structure, function, and interactions of recombinant Cercocebus galeritus MT-CO2. This information can contribute to a better understanding of the species' physiology, evolutionary history, and conservation needs.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Cercocebus galeritus (Tana river mangabey)
Target Names
Target Protein Sequence
MAHPVQLGLQDATSPVMEELITFHDHALMAMSLISLLVLYALFSTLTTKLTNTNITDAQE MEIIWTILPAIILVLIALPSLRILYLTDEVNNPSFTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLNPGDLRLLEVDNRVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLN QTVFTATRPGVYYGQCSEICGANHSFMPIVAELIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function

Recombinant Cercocebus galeritus Cytochrome c oxidase subunit 2 (MT-CO2): Background Information

MT-CO2 is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site, a binuclear center (BNC), consists of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 from Cercocebus galeritus?

Cytochrome c Oxidase Subunit 2 (MT-CO2) from Cercocebus galeritus (Tana river mangabey) is a mitochondrially-encoded protein that functions as a critical component of Complex IV in the electron transport chain. The protein is also known as Cytochrome c Oxidase polypeptide II and is encoded by the MT-CO2 gene (with synonyms including COII, COXII, and MTCO2). The full-length protein spans expression region 1-227 and has a UniProt accession number of P98020 . MT-CO2 plays an essential role in cellular respiration by facilitating the transfer of electrons from cytochrome c to molecular oxygen, contributing to the maintenance of the proton gradient necessary for ATP synthesis.

How is recombinant MT-CO2 from Cercocebus galeritus stored and handled in laboratory settings?

Recombinant MT-CO2 from Cercocebus galeritus should be stored at -20°C for routine use, with extended storage recommended at either -20°C or -80°C to maintain protein integrity. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein . For experimental work, it is advisable to create working aliquots stored at 4°C that should be used within one week. Repeated freeze-thaw cycles should be avoided as they can compromise protein stability and activity. Laboratory protocols should include measures to minimize exposure to room temperature and implement proper thawing procedures to preserve the structural and functional properties of the protein.

What techniques can be used to evaluate the functional activity of recombinant MT-CO2 in experimental settings?

Several methodological approaches can be employed to assess the functional activity of recombinant MT-CO2:

  • Cytochrome c Oxidase Activity Assays: Spectrophotometric measurements can track the oxidation of reduced cytochrome c at 550 nm. The rate of decrease in absorbance correlates with enzyme activity.

  • Oxygen Consumption Measurements: Using oxygen electrode systems (Clark-type electrodes or Seahorse XF analyzers) to measure oxygen consumption rates in reconstituted systems or in cells expressing the recombinant protein.

  • Blue Native PAGE: This technique allows for analysis of intact respiratory complexes and can be followed by in-gel activity assays to assess the incorporation of recombinant MT-CO2 into functional Complex IV.

  • Protein-Protein Interaction Studies: Co-immunoprecipitation or proximity ligation assays can evaluate the interaction of recombinant MT-CO2 with other subunits of Complex IV or relevant binding partners.

  • Mitochondrial Membrane Potential Assessments: Using fluorescent dyes like JC-1 or TMRM to assess whether incorporation of recombinant MT-CO2 affects the establishment and maintenance of mitochondrial membrane potential.

The choice of method should be determined by the specific research question and the experimental system being utilized.

How can researchers verify the purity and identity of recombinant Cercocebus galeritus MT-CO2?

Verification of recombinant Cercocebus galeritus MT-CO2 purity and identity should employ multiple complementary techniques:

  • SDS-PAGE and Western Blotting: The protein can be separated by SDS-PAGE and transferred to nitrocellulose membranes for immunodetection using monoclonal antibodies specific to MT-CO2. This approach, similar to techniques described for SIV viral proteins, allows for size verification and initial purity assessment .

  • Mass Spectrometry: Peptide mass fingerprinting or tandem mass spectrometry can confirm the protein sequence and identify any post-translational modifications.

  • ELISA: Antibody-based detection methods can verify reactivity with MT-CO2-specific antibodies, confirming both identity and the preservation of key epitopes .

  • Circular Dichroism: This technique can assess secondary structure elements to ensure proper protein folding.

  • Size Exclusion Chromatography: This can evaluate protein homogeneity and detect potential aggregation or degradation products.

  • Functional Assays: Activity measurements serve as a final verification that the protein is not only pure and correctly identified but also functionally active.

A comprehensive verification approach should include at least three different methods to ensure confidence in the protein preparation's quality.

How can recombinant MT-CO2 be used to study pathogenic variants and their effects on mitochondrial function?

Recombinant MT-CO2 provides a valuable tool for investigating the functional consequences of pathogenic MT-CO2 variants through several sophisticated approaches:

  • Site-Directed Mutagenesis: Researchers can introduce specific mutations observed in patients with mitochondrial disorders into recombinant MT-CO2. For example, mutations associated with cerebellar ataxia and neuropathy can be created in the recombinant protein to study their biochemical effects .

  • In Vitro Reconstitution Studies: Mutant and wild-type recombinant proteins can be incorporated into liposomes or nanodiscs containing other respiratory chain components to assess functional differences.

  • Heteroplasmy Modeling: By mixing wild-type and mutant recombinant proteins in different ratios, researchers can model heteroplasmy—a critical factor in mitochondrial disease presentation where mutant and wild-type mtDNA coexist in varying proportions .

  • Structural Studies: X-ray crystallography or cryo-electron microscopy can be used to determine structural changes induced by pathogenic variants, providing insights into disease mechanisms.

  • Cell-Based Complementation Assays: MT-CO2-deficient cell lines can be complemented with wild-type or mutant recombinant proteins to assess rescue of mitochondrial function.

These approaches allow for dissection of molecular mechanisms underlying MT-CO2-related disorders, which include myopathy, MELAS syndrome, neurodevelopmental delay, and progressive cerebellar ataxia .

What techniques are used to assess heteroplasmy levels in tissues when studying MT-CO2 variants?

Accurate quantification of heteroplasmy levels is crucial for understanding MT-CO2 variant pathogenicity. The following methodological approaches are commonly employed:

  • Quantitative Pyrosequencing: This technique can accurately determine heteroplasmy levels with a detection limit of >3%. Pyrosequencing assays performed on a PyroMark Q24 platform using variant-specific primers allow for precise quantification across different tissue types .

  • Next-Generation Sequencing: Deep sequencing approaches provide high-resolution quantification of heteroplasmy levels and can detect low-level variants that might be missed by other methods.

  • Digital PCR: This method offers absolute quantification of mutant and wild-type molecules without requiring standard curves.

  • Laser-Capture Microdissection: This can be combined with other quantitative methods to assess heteroplasmy at the single-cell level, allowing for the isolation of specific cell types (e.g., COX-deficient and COX-positive muscle fibers) for subsequent analysis .

  • Multi-Tissue Analysis: Comprehensive assessment should include analysis of multiple tissues, as heteroplasmy levels can vary significantly between tissues due to mitotic segregation and tissue-specific selection pressures. Studies commonly examine skeletal muscle, urinary sediments, blood, and buccal epithelia .

The table below summarizes the advantages and limitations of these techniques:

TechniqueDetection LimitAdvantagesLimitations
Quantitative Pyrosequencing>3%Rapid, cost-effective, good for targeted variantsLimited to known variants
Next-Generation Sequencing~1%Comprehensive, detects novel variantsHigher cost, complex data analysis
Digital PCR~0.1%Highest sensitivity, absolute quantificationLimited multiplexing capacity
Laser-Capture MicrodissectionDependent on downstream methodSingle-cell resolutionLabor-intensive, requires specialized equipment

How do MT-CO2 variants manifest clinically and what metabolic markers are associated with these conditions?

MT-CO2 variants are associated with diverse clinical presentations, with syndrome-specific manifestations:

  • Neurological Presentations: Progressive cerebellar ataxia and neuropathy represent non-syndromic presentations that can be diagnostically challenging. Patients may exhibit gait disorders and neurodevelopmental delays .

  • Muscle-Related Symptoms: Myopathy with or without recurrent myoglobinuria is a common manifestation, affecting muscle strength and function .

  • Multisystem Involvement: Some patients present with cardiac involvement, retinitis pigmentosa, and lactic acidosis alongside neurological symptoms .

  • MELAS-Like Syndrome: MT-CO2 variants can occasionally present with features resembling Mitochondrial Encephalopathy, Lactic Acidosis, and Stroke-like episodes (MELAS) .

Metabolic markers associated with MT-CO2 variants include:

  • Abnormal Acylcarnitine Profiles: Patients with MT-CO2 variants show distinctive acylcarnitine patterns that may mimic those seen in primary fatty acid oxidation disorders, particularly multiple acyl-CoA dehydrogenase deficiency (MADD) .

  • Elevated Lactate: Lactic acidosis is common due to impaired oxidative phosphorylation.

  • Respiratory Chain Complex Activity: Biochemical assays typically show isolated Complex IV deficiency.

Interestingly, the perturbation of fatty acid oxidation pathways appears to be secondary to mitochondrial respiratory chain dysfunction in these patients, highlighting the interconnectedness of these metabolic pathways .

What is the significance of muscle biopsy in diagnosing MT-CO2-related disorders in the era of next-generation sequencing?

Despite advances in genetic testing technologies, muscle biopsy remains an essential diagnostic tool for MT-CO2-related disorders for several reasons:

  • Tissue-Specific Heteroplasmy: MT-CO2 variants often show tissue-specific distribution patterns, with muscle frequently harboring higher mutation loads than blood or other easily accessible tissues. Reliance solely on blood-derived DNA can lead to false negatives or underestimation of mutation loads .

  • Histochemical and Biochemical Analyses: Muscle biopsies allow for histochemical stains such as cytochrome c oxidase (COX)/succinate dehydrogenase (SDH) to identify COX-deficient fibers. These analyses provide functional evidence of mitochondrial dysfunction that complements genetic findings .

  • Single Fiber Analysis: Laser-capture microdissection of individual muscle fibers enables correlation of genetic abnormalities with functional defects at the single-cell level. This approach is particularly valuable for establishing pathogenicity of novel MT-CO2 variants .

  • Biochemical Confirmation: Direct measurement of respiratory chain complex activities in muscle provides functional validation of genetic findings.

  • Resolution of Variant Pathogenicity: When multiple mtDNA variants are identified, muscle biopsy analysis can help determine which variants segregate with the biochemical defect, as demonstrated in a case where two heteroplasmic MT-CO2 variants were identified, but only one proved to be causal based on segregation studies in muscle .

Experts emphasize that muscle biopsy remains a vital diagnostic investigation even in the era of next-generation sequencing, particularly for non-syndromic presentations of mtDNA-related adult disease which can be diagnostically challenging .

What controls should be included when conducting functional studies with recombinant Cercocebus galeritus MT-CO2?

Robust experimental design for functional studies with recombinant Cercocebus galeritus MT-CO2 should include multiple controls:

  • Positive Control: Include commercially available, well-characterized cytochrome c oxidase or reconstituted Complex IV with known activity levels. This establishes a benchmark for expected activity.

  • Negative Control: Use heat-denatured MT-CO2 or samples lacking critical components to define baseline measurements and non-specific activity.

  • Species Comparisons: When possible, include recombinant MT-CO2 from other species (human, mouse, etc.) to identify species-specific functional characteristics and evolutionary adaptations.

  • Buffer Controls: Test the effects of storage buffer components (Tris, glycerol) on experimental readouts to distinguish protein-specific effects from buffer effects.

  • Concentration Gradients: Perform dose-response experiments to establish linearity of the assay within the concentration range being tested.

  • Time Course Studies: Conduct measurements at multiple time points to ensure observations are made during the linear phase of enzyme activity.

  • Substrate Variants: When applicable, use different substrates or substrate analogs to characterize enzyme specificity.

  • Inhibitor Controls: Include known inhibitors of cytochrome c oxidase (e.g., cyanide, azide) to validate assay specificity and establish inhibition profiles.

Properly designed controls enhance data reliability and facilitate interpretation of results, particularly when investigating novel aspects of MT-CO2 function or when comparing wild-type and variant proteins.

How should researchers approach the characterization of novel MT-CO2 variants identified in clinical specimens?

A comprehensive approach to characterizing novel MT-CO2 variants should integrate multiple lines of evidence:

  • Bioinformatic Analysis:

    • Conservation analysis across species

    • Structural modeling to predict impact on protein function

    • Pathogenicity prediction using algorithms like PolyPhen-2, SIFT, and MutationTaster

    • Population frequency data from databases like gnomAD to assess rarity

  • Genetic Studies:

    • Quantification of heteroplasmy across multiple tissues

    • Family segregation studies when possible

    • Single-fiber PCR to correlate genotype with COX deficiency

  • Biochemical Characterization:

    • Site-directed mutagenesis to introduce the variant into recombinant MT-CO2

    • Enzymatic activity assays comparing wild-type and variant proteins

    • Protein stability and folding assessments

    • Complex assembly studies using blue native PAGE

  • Cellular Models:

    • Cybrid cell lines harboring the variant at different heteroplasmy levels

    • Functional assessments including oxygen consumption, ATP production, and reactive oxygen species generation

    • Mitochondrial network dynamics and morphology

  • Tissue Analyses:

    • Histochemical studies of patient biopsies

    • Immunohistochemistry to assess MT-CO2 protein levels

    • Biochemical measurement of respiratory chain complexes

  • Metabolomic Profiling:

    • Analysis of acylcarnitine profiles, which can mimic patterns seen in fatty acid oxidation disorders

    • Assessment of TCA cycle intermediates and other mitochondrial metabolites

This multi-faceted approach provides robust evidence for variant pathogenicity and offers insights into disease mechanisms that can guide potential therapeutic strategies.

What are the emerging research directions for Cercocebus galeritus MT-CO2 in comparative mitochondrial biology?

The study of Cercocebus galeritus MT-CO2 offers several promising research directions:

  • Evolutionary Adaptations: Comparative analyses between Cercocebus galeritus and other primates can reveal evolutionary adaptations in mitochondrial function that may relate to species-specific metabolic requirements, environmental adaptations, or disease resistance.

  • Interspecies Differences in Pathogenic Variants: Investigating how variants that are pathogenic in humans affect mangabey MT-CO2 could provide insights into species-specific compensatory mechanisms and tolerance to mitochondrial dysfunction.

  • Tissue-Specific Expression Patterns: Exploration of tissue-specific expression and post-translational modification patterns of MT-CO2 across different primate species may reveal important regulatory mechanisms.

  • Mitochondrial-Nuclear Communication: Investigation of species differences in the interaction between MT-CO2 and nuclear-encoded proteins could illuminate co-evolutionary processes in mitochondrial function.

  • Biomarker Development: The unique properties of Cercocebus galeritus MT-CO2 may be leveraged for the development of species-specific biomarkers for mitochondrial dysfunction.

These research directions not only advance our understanding of basic mitochondrial biology but also have potential applications in evolutionary medicine, conservation biology, and the development of novel diagnostic approaches for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.