Recombinant Cercopithecine herpesvirus 9 Envelope glycoprotein I (GI)

Shipped with Ice Packs
In Stock

Description

General Information

Glycoprotein I (gI) is an envelope glycoprotein of CeHV-1 . In epithelial cells, gI, in conjunction with gE, facilitates the spread of the virus between cells by directing newly formed virions to cell junctions . At these junctions, the virus can rapidly infect neighboring cells through interactions with cellular receptors . Recombinant gI is produced using various expression systems, including Baculovirus and Yeast .

Production and Characteristics

Recombinant CeHV-1 gI (1-109 aa) can be expressed in Baculovirus or Yeast with a His-tag or Tag-free . The biological activity of the recombinant protein is determined by its binding ability in a functional ELISA .

Key characteristics of Recombinant CeHV-1 gI:

CharacteristicDescription
SourceBaculovirus or Yeast
SpeciesCercopithecine herpesvirus 1 (CeHV-1)
Fragment1-109 amino acids
SequenceMGRLLGFLLA LGPWALVAGV VIRGPTISLV SDSLLAAGAV GANGSFLEDL EVPGELHFLG PQVPHVTYYD GSVELLHYPP DARCPRAVLV EEMTACPRRN AVAFTLCRS
TagHis-tag or Tag-free
Purity>90%, as determined by SDS-PAGE
ConjugationUnconjugated
TargetgI
Full NameEnvelope glycoprotein I
Uniprot IDP36343
Biological ActivityDetermined by its binding ability in a functional ELISA

Role in Viral Infection

Glycoproteins like gI, gE, gC, and gD play crucial roles in HSV immune evasion . The gE/gI complex prevents antibody-mediated viral neutralization and facilitates the clearance of viral antigens and antiviral antibodies from the cell surface . In herpesviruses, including B virus, the concerted action of multiple glycoproteins is essential for viral entry and spread . For example, gD initiates interactions critical for successful HSV infection . Conformational changes in gD, triggered by receptor binding, lead to interactions with gH/gL, which subsequently interact with gB to stimulate its fusogenic activity .

Diagnostic Applications

Recombinant B virus glycoproteins, including gI, can be used in enzyme-linked immunosorbent assays (ELISAs) to detect IgG antibodies in monkey and human sera . The use of recombinant proteins allows for the rapid identification of B virus-infected animals by detecting humoral immune responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gI; US3; Envelope glycoprotein I; Membrane glycoprotein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-353
Protein Length
full length protein
Species
Cercopithecine herpesvirus 9 (strain DHV) (CeHV-9) (Simian varicella virus)
Target Names
gI
Target Protein Sequence
GIQCAAAIIYRGNYISLYVNSSATSIFLKGNNNDASIRGRFLFIGDQFPVTNTYNVTVEL LHVNQTTLCLQPLYRVMYGECPRIRTGAIIACRVKRSWHYENATQLTDPNVEIIFKMNNT KVEDAGIYLLVVQLDYTSLFDIFFVSLNVYPKQDTSNEDVNYFPPVYSPSHILNTFKICH KFPVHNGMEQSILQHIVTSDVDTETENLSWQKDDLGSTQKPRKNFNPDVKVNVTHETRKT LMESSADVFMIAVPITASLLVILAIIIVVTVGIYRRRSSEKRKIYRPKRTKEQASTEKRE RSESDVLLEAAVARLETIQEENPPHSVINPFTK
Uniprot No.

Target Background

Function

In epithelial cells, the gE/gI heterodimer is crucial for cell-to-cell viral spread. It facilitates the sorting of nascent virions to cell junctions, enabling rapid spread to adjacent cells via interactions with junctional cellular receptors. It's implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for anterograde spread of infection throughout the nervous system. In conjunction with US9, gE/gI participates in the sorting and transport of viral structural components to axon terminals.

Database Links

KEGG: vg:920526

Protein Families
Alphaherpesvirinae glycoprotein I family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass type I membrane protein. Host cell junction. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What biological functions does gI serve in viral pathogenesis?

Glycoprotein I serves multiple critical functions in Cercopithecine herpesvirus 9 pathogenesis:

  • Cell-to-cell spread: When complexed with gE, the gE/gI heterodimer is essential for the cell-to-cell spread of the virus in epithelial cells. This heterodimer functions by sorting nascent virions to cell junctions, facilitating rapid viral transmission to adjacent cells through interactions with cellular receptors concentrated at these junctions .

  • Neuronal transmission: In neuronal cells, the gE/gI complex is crucial for anterograde spread of infection throughout the host nervous system .

  • Polarized cell infection: The gE/gI complex contributes to basolateral spread in polarized cells, allowing the virus to navigate the specific architecture of these cell types .

  • Immune evasion: Similar to other alphaherpesviruses, the gE/gI complex likely plays a role in immune evasion strategies, potentially by interfering with antibody-mediated neutralization.

  • Virulence determination: As observed in related herpesviruses like BHV-1, the gI protein contributes significantly to viral virulence, making it an important target for attenuated vaccine development .

How can researchers express recombinant gI protein for experimental studies?

Several expression systems have been successfully employed for the production of recombinant Cercopithecine herpesvirus 9 gI, each with specific advantages:

Expression SystemAdvantagesChallengesApplications
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, potential improper foldingELISA, Western blot, immunoprecipitation
Baculovirus/Insect cellsBetter post-translational modifications, higher solubilityMore complex than bacterial systems, moderate yieldStructural studies, functional assays
Mammalian cells (CHO, HEK293)Proper glycosylation and folding, authentic structureLower yield, higher cost, longer production timeNeutralization assays, receptor binding studies

For E. coli expression systems, researchers typically use:

  • A bacterial expression vector containing a strong promoter (T7, tac)

  • N-terminal His-tag or alternative purification tags for simplified purification

  • Optimization of induction conditions (IPTG concentration, temperature, induction time)

  • Inclusion body solubilization and refolding protocols if necessary

For baculovirus expression systems, researchers can adapt protocols similar to those used for other herpesvirus glycoproteins:

  • Cloning the gI extracellular domain into a baculovirus transfer vector

  • Incorporating secretion signals like honeybee melittin

  • Adding epitope tags for detection (V5, His)

  • Generating recombinant baculoviruses via transposition

  • Optimizing expression by testing different MOIs (4-7) and harvest times (typically 72 hours post-infection)

What assays are used to verify the biological activity of recombinant gI?

Verifying the biological activity of recombinant Cercopithecine herpesvirus 9 gI involves multiple complementary approaches:

  • Functional ELISA: The most common method involves testing the binding ability of recombinant gI in a functional ELISA, where the protein's capacity to interact with specific antibodies or receptors is quantitatively measured .

  • Protein-protein interaction assays:

    • Co-immunoprecipitation with gE to verify heterodimer formation

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Yeast two-hybrid or mammalian two-hybrid assays to detect interactions

  • Cell-based assays:

    • Cell-cell fusion assays using gI-expressing cells

    • Viral entry inhibition assays using recombinant gI as a competitive inhibitor

    • Complementation assays in gI-deleted viral mutants

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify protein folding

    • Limited proteolysis to confirm structural stability

    • Size-exclusion chromatography to verify oligomeric state

A comprehensive activity assessment protocol typically includes:

  • Initial characterization by SDS-PAGE and Western blot

  • Functional ELISA using anti-gI antibodies

  • Analysis of gE binding capability

  • Evaluation of receptor binding function

How can CRISPR/Cas9 technology be applied to study gI function?

CRISPR/Cas9 technology has emerged as a powerful tool for manipulating herpesvirus genomes, including Cercopithecine herpesvirus 9, to study glycoprotein functions:

  • Gene deletion/knockout approaches:

    • Design guide RNAs (gRNAs) targeting the gI gene

    • Construct a donor plasmid containing homology arms flanking the gI gene region

    • Include a reporter gene (e.g., eGFP) for easy identification of successful editing

    • Transfect cells with both CRISPR/Cas9 components and the donor plasmid

    • Identify and isolate recombinant viruses expressing the reporter gene

  • Precise gene editing strategies:

    • Design gRNAs targeting specific domains within the gI gene

    • Create donor templates carrying desired mutations flanked by homology arms

    • Integrate specific mutations to study structure-function relationships

  • Experimental workflow for gI gene replacement:

    • Construct recombinant plasmids containing left and right arms of the gI gene

    • Clone an eGFP reporter gene between these arms

    • Co-transfect with CRISPR/Cas9 components targeting gI

    • Upon gI cleavage by Cas9, homologous recombination replaces gI with eGFP

    • Select and purify gI-/eGFP+ viral recombinants

This approach has been successfully implemented for other alphaherpesviruses like bovine herpesvirus-1 (BHV-1), where gI and gE genes were replaced with eGFP using CRISPR/Cas9, resulting in the generation of attenuated candidate vaccine strains .

What are the optimal methods for purifying recombinant gI to ensure functionality?

Purification of biologically active recombinant gI requires careful consideration of protein characteristics and intended applications:

  • Affinity chromatography approaches:

    • For His-tagged constructs: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co2+ matrices

    • For tag-free constructs: Immunoaffinity chromatography using anti-gI antibodies

    • Optimal elution conditions typically involve imidazole gradients (for His-tagged proteins) or pH shifts (for immunoaffinity)

  • Additional purification steps:

    • Ion exchange chromatography based on gI's isoelectric point

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Hydrophobic interaction chromatography for removing contaminants

  • Critical parameters to monitor:

    • Maintenance of reducing conditions to preserve disulfide bonds

    • Temperature control during purification (typically 4°C)

    • Buffer composition optimization (pH, salt concentration, stabilizing agents)

    • Immediate assessment of biological activity after each purification step

  • Quality control metrics:

    • SDS-PAGE with Coomassie staining to verify >90% purity

    • Western blot analysis to confirm identity

    • Dynamic light scattering to assess homogeneity

    • Endotoxin testing for preparations intended for cellular assays

For E. coli-expressed gI, proteins are often found in inclusion bodies, requiring specialized solubilization and refolding protocols using chaotropic agents (urea or guanidine hydrochloride) followed by controlled refolding via dialysis or dilution.

How does recombinant gI compare structurally and functionally to native viral gI?

Understanding the similarities and differences between recombinant and native gI is crucial for experimental design and data interpretation:

  • Structural differences:

    • Glycosylation patterns: E. coli-expressed gI lacks glycosylation, while insect cell-expressed gI has simplified glycans compared to native viral gI

    • Folding variations: Recombinant proteins may adopt slightly different tertiary structures

    • Truncation effects: Many recombinant constructs (e.g., aa 21-353 or aa 21-274) lack transmembrane domains and cytoplasmic tails

  • Functional implications:

    • Receptor binding: Correctly folded recombinant gI generally maintains receptor binding capability

    • Complex formation: Recombinant gI can still form complexes with gE in vitro

    • Antigenicity: Properly folded recombinant gI preserves most conformational epitopes

  • Experimental considerations:

    • For structural studies: Higher eukaryotic expression systems are preferred

    • For binding assays: E. coli-expressed proteins may be sufficient

    • For immunological studies: Glycosylation status must be considered

Researchers can validate the structural integrity of recombinant gI through comparative analyses with native gI using:

  • Conformational antibody recognition patterns

  • Protease sensitivity profiles

  • Circular dichroism spectroscopy

  • Thermal stability assays

What approaches can be used to map functional domains and epitopes within gI?

Mapping functional domains and epitopes of Cercopithecine herpesvirus 9 gI requires systematic approaches:

  • Truncation analysis:

    • Generate a series of N- and C-terminal truncations

    • Express and purify each truncated variant

    • Assess each variant for specific functions (binding to gE, receptors, etc.)

    • Identify minimal regions required for each function

  • Site-directed mutagenesis:

    • Target conserved residues based on sequence alignment with other herpesvirus gI proteins

    • Generate point mutations or small deletions

    • Evaluate effects on specific functions

    • Identify critical residues for each activity

  • Epitope mapping techniques:

    • Peptide scanning: Synthesize overlapping peptides spanning the gI sequence

    • Phage display: Express gI fragments on phage surfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify antibody binding regions

    • X-ray crystallography of antibody-antigen complexes

  • Cross-species comparative approach:

    • Align gI sequences from different herpesviruses

    • Identify conserved versus variable regions

    • Construct chimeric proteins to map species-specific functions

This approach has been successfully employed for B virus (Cercopithecine herpesvirus 1) glycoprotein D, where the immunodominant epitope (gD 362-370) was identified within the C-terminal region through systematic screening of epitope libraries with serum from infected macaques .

How should researchers address contradictory results between in vitro and in vivo studies of gI function?

Reconciling contradictory findings between in vitro and in vivo gI functional studies requires systematic investigation:

  • Systematic troubleshooting approach:

    • Validate protein folding and activity in each experimental system

    • Consider differences in expression levels and localization

    • Assess the influence of other viral proteins in complex systems

    • Evaluate model-specific factors (cell types, animal models)

  • Experimental reconciliation strategies:

    • Use multiple complementary in vitro systems

    • Develop more physiologically relevant in vitro models (e.g., organoids)

    • Employ ex vivo systems as intermediates between in vitro and in vivo

    • Conduct dose-response studies to identify threshold effects

  • Advanced analytical methods:

    • Systems biology approaches to model complex interactions

    • Computational modeling to predict behavior in different contexts

    • High-throughput screens to identify context-dependent cofactors

  • Reporting and interpretation guidelines:

    • Clearly document experimental conditions

    • Report all negative and contradictory results

    • Consider multiple hypotheses that could explain discrepancies

    • Design critical experiments specifically to resolve contradictions

A comprehensive approach often includes:

  • Verification of recombinant protein quality and activity

  • Comparative analysis in multiple cell lines

  • Ex vivo testing in primary tissues

  • Targeted in vivo experiments designed to address specific discrepancies

What are promising applications of gI research in vaccine development?

Research on Cercopithecine herpesvirus 9 gI offers several promising avenues for vaccine development:

  • Attenuated vaccine strategies:

    • CRISPR/Cas9 deletion of gI gene creates attenuated viral strains

    • gI-deleted viruses typically show reduced virulence while maintaining immunogenicity

    • This approach has proven successful with other alphaherpesviruses like BHV-1

  • Subunit vaccine approaches:

    • Recombinant gI proteins as vaccine antigens

    • gI combined with other glycoproteins (particularly gE) for enhanced protection

    • Optimization of expression systems for high-quality antigen production

  • Experimental design considerations:

    • Adjuvant selection to enhance immune responses

    • Prime-boost strategies to improve antibody quality

    • Delivery system optimization for proper antigen presentation

  • Evaluation metrics:

    • Neutralizing antibody titers

    • Cell-mediated immune responses

    • Protection against challenge in animal models

    • Duration of immunity

The rapid genome editing approach using CRISPR/Cas9 established for alphaherpesviruses provides a technology platform that could be adapted for CeHV-9 to construct genetically engineered anti-viral vaccines .

How can computational approaches enhance gI structure-function studies?

Computational methods offer powerful tools for understanding CeHV-9 gI structure and function:

  • Structural prediction approaches:

    • Homology modeling based on related herpesvirus glycoprotein structures

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to study flexibility and conformational changes

    • Analysis of protein-protein interaction interfaces

  • Epitope prediction methods:

    • B-cell epitope prediction algorithms

    • T-cell epitope mapping in context of different HLA types

    • Identification of conserved versus variable regions for differential diagnosis

  • Immunoinformatic analyses:

    • HLA binding affinity predictions for gI peptides

    • Identification of potential cross-reactive epitopes with human herpesvirus glycoproteins

    • Integration with experimental validation data

  • Applications in experimental design:

    • Rational design of mutations for functional studies

    • Optimization of recombinant protein constructs

    • Planning of epitope mapping experiments

    • Design of diagnostic assays with maximum specificity

Recent immunogenetic profile studies of herpesvirus envelope glycoproteins demonstrate the value of computational approaches in predicting binding affinities with HLA molecules, which could be applied to CeHV-9 gI to better understand host immune responses .

What controls and validation steps are essential when working with recombinant gI?

Rigorous controls and validation are critical for generating reliable data with recombinant CeHV-9 gI:

  • Expression and purification controls:

    • Empty vector control processed identically to gI construct

    • Known functional protein (e.g., another well-characterized glycoprotein) as positive control

    • Multiple purification batches to assess consistency

    • Fresh versus stored protein comparisons to evaluate stability

  • Functional validation approaches:

    • Binding assays with validated antibodies or ligands

    • Complex formation with recombinant gE

    • Comparison with native viral protein when available

    • Activity testing before and after each experimental manipulation

  • Quality control metrics:

    • Purity assessment by SDS-PAGE (>90% recommended)

    • Identity confirmation by mass spectrometry

    • Endotoxin testing for cell-based experiments

    • Aggregation status by dynamic light scattering

  • Experimental design controls:

    • Dose-response relationships to establish specificity

    • Competition assays with known ligands

    • Inclusion of structurally similar but functionally distinct proteins

    • Blocking studies to confirm specific interactions

Each experiment should include appropriate positive and negative controls designed specifically for the particular assay and research question being addressed.

What are the most effective strategies for studying gI-gE complex formation?

The gI-gE complex is critical for CeHV-9 function, and its study requires specialized approaches:

  • Co-expression strategies:

    • Bicistronic vectors for coordinated expression

    • Sequential purification using different tags on each protein

    • Optimization of expression stoichiometry

    • Cell-based co-expression followed by in situ analysis

  • In vitro complex formation methods:

    • Mixing purified recombinant gI and gE under various conditions

    • Monitoring association by size-exclusion chromatography

    • Analysis by native PAGE or blue native PAGE

    • Surface plasmon resonance to determine binding kinetics

  • Complex characterization techniques:

    • Chemical crosslinking followed by mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

    • Cryo-electron microscopy for structural analysis

    • FRET-based approaches to study dynamics

  • Functional analysis of the complex:

    • Receptor binding assays comparing individual proteins versus complex

    • Cell-to-cell spread assays in transfected or infected cells

    • Antibody neutralization studies targeting complex-specific epitopes

    • Mutagenesis of interface residues to disrupt complex formation

These approaches can build upon methods successfully employed for studying other herpesvirus glycoprotein complexes, including those of B virus (Cercopithecine herpesvirus 1) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.