Recombinant Cercopithecus diana Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Cercopithecus diana Melanocyte-stimulating hormone receptor (MC1R) is a genetically engineered protein derived from the melanocortin 1 receptor gene of the Diana monkey (Cercopithecus diana). As a G protein-coupled receptor (GPCR), MC1R regulates melanogenesis, UV responses, and pigmentation pathways by interacting with α-melanocyte-stimulating hormone (α-MSH) and antagonistic ligands like agouti signaling protein (ASIP) . This recombinant variant is critical for studying evolutionary biology, dermatological disorders, and melanoma risk .

Expression Systems

  • Host: Primarily expressed in E. coli , with alternative systems including yeast, baculovirus, and mammalian cells .

  • Yield: Typically produced as a lyophilized powder with ≥90% purity (SDS-PAGE) .

Signaling Mechanisms

  • Ligand Binding:

    • Agonists: α-MSH activates MC1R, increasing cAMP via Gαs-coupled adenylate cyclase .

    • Antagonists: ASIP competitively inhibits α-MSH binding, reducing basal cAMP .

    • Neutral Antagonist: β-defensin 3 (βD3) blocks both α-MSH and ASIP without affecting basal signaling .

  • Downstream Effects:

    • Stimulates eumelanin synthesis and DNA repair via p53/ATR pathways .

    • Enhances antioxidant defenses and nucleotide excision repair (NER) .

Dimerization and Trafficking

  • MC1R forms constitutive homodimers via disulfide bonds (C35 essential for ER-to-plasma membrane transport) .

  • Mutant MC1R dimers exhibit dominant-negative effects on wild-type receptor localization .

Applications in Research

ApplicationUtility
Melanoma StudiesInvestigates UV resistance mechanisms and melanoma risk
Pigmentation GeneticsModels evolutionary adaptations in primate coat color
Drug DevelopmentScreens for agonists/antagonists targeting hyperpigmentation disorders
DNA Repair PathwaysElucidates MC1R’s role in γH2AX/XPC-mediated repair

Comparative Analysis with Other Primate MC1R Variants

SpeciesKey Differences
Pan troglodytes (Chimp)Polymorphic sites (e.g., R260C) linked to functional divergence
Leontopithecus spp.8-amino-acid deletion in extracellular loop; altered ligand binding
Cebus spp.Extended ORF due to stop codon mutations

Research Findings and Implications

  • Desensitization: GRK2/6 phosphorylate MC1R, promoting β-arrestin-2 (ARRB2)-mediated internalization .

  • Evolutionary Insights: MC1R in Cercopithecus diana shows conserved residues critical for basal signaling, unlike polymorphic variants in tamarins .

  • Therapeutic Potential: Targeting MC1R dimerization could modulate melanogenesis in vitiligo or melasma .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Cercopithecus diana (Diana monkey)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTAPPHLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYIHMLVRACQHAQGIARLHKRQRPAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor acts as a receptor for Melanocyte-stimulating hormone (MSH) (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. The receptor plays a key role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling within melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MC1R receptor and what is its functional role in Cercopithecus diana?

MC1R (Melanocortin-1 Receptor) is a G protein-coupled receptor expressed primarily in melanocytes that plays a crucial role in regulating melanin production and pigmentation patterns. In Cercopithecus diana, which displays distinctive black, white, and red-brown/orange coloration patterns, MC1R likely contributes significantly to this phenotypic expression . The receptor functions by binding α-melanocyte stimulating hormone (α-MSH), which activates adenylyl cyclase and increases intracellular cAMP levels, ultimately promoting eumelanin (black/brown pigment) synthesis over pheomelanin (yellow/red pigment) . The distinctive coloration of Diana monkeys, including their generally black body with white throat, ruff, pointed beard, and anterior arms, alongside red-brown to orange posterior back and thighs, makes them an excellent model for studying MC1R function in primate pigmentation .

What expression systems are most suitable for studying recombinant Cercopithecus diana MC1R?

Based on established protocols for MC1R research, mammalian expression systems are most suitable for recombinant Cercopithecus diana MC1R studies. COS-7 cells (derived from African green monkey kidney) provide an optimal expression system as they are closely related phylogenetically and have been successfully used for MC1R studies in other species . These cells should be cultivated in DMEM supplemented with 10% FBS at 37°C in a humidified 5% CO2 incubator . Recombinant plasmids can be prepared by inserting the MC1R coding sequence into mammalian expression vectors like pcDps, with N-terminal hemagglutinin (HA) and C-terminal flag epitope tags to facilitate detection and purification . LipoFiter Liposomal Transfection Reagent or similar transfection methods can be employed for efficient cell transfection, with a green fluorescent protein-based plasmid serving as a control .

How can the functional activity of recombinant Cercopithecus diana MC1R be measured?

The functional activity of recombinant Cercopithecus diana MC1R can be assessed through several complementary approaches:

  • cAMP accumulation assay: Measure intracellular cAMP levels in response to increasing concentrations of α-MSH (typically 10^-6 to 10^-7 mol/l) to determine receptor signaling capacity .

  • Receptor expression analysis: Quantify both total protein expression and cell-surface expression using epitope tags incorporated into the recombinant construct .

  • Dose-response curves: Generate dose-response curves to determine EC50 values (the concentration of α-MSH required for half-maximal activation) .

  • Comparison with known MC1R variants: Compare signaling efficiency with established functional or dysfunctional MC1R variants to categorize receptor activity .

The table below outlines a typical experimental design for functional characterization:

Assay TypeMeasurementControlExpected Outcome
cAMP AccumulationIntracellular cAMP levels after α-MSH stimulationUntransfected cells, GFP-transfected cellsDose-dependent increase in cAMP
Cell Surface ExpressionReceptor density at plasma membraneTotal protein expressionPercentage of total receptor at surface
Ligand BindingBinding affinity (Kd) of α-MSHNon-specific bindingSaturation binding curve
Signal TransductionResponse to varying α-MSH concentrationsKnown functional/dysfunctional variantsEC50 value determination

What are the expected sequence variations in the MC1R gene across Cercopithecus diana populations?

Based on patterns observed in other species, MC1R sequence variations in Cercopithecus diana populations would likely correlate with geographic distribution and environmental adaptations. Similar to studies in other species, we would expect:

  • Nonsynonymous (amino-acid-changing) coding region variants, particularly in transmembrane domains and near the extracellular N-terminus .

  • Population-specific MC1R protein types that may correlate with regional pigmentation differences, potentially reflecting adaptations to different forest habitats across their Western African range (Sierra Leone to Ghana) .

  • Selection signatures at specific amino acid positions that contribute to functional differences in melanin synthesis, potentially influenced by varying environmental conditions across elevational or geographical gradients .

The most informative sites would likely be those in transmembrane domains, as these regions are generally highly conserved in vertebrates, and substitutions here have been associated with color variation in several species .

How can site-directed mutagenesis be applied to investigate functional domains in Cercopithecus diana MC1R?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in Cercopithecus diana MC1R. Based on established protocols, researchers should:

  • Target key amino acid positions: Focus on residues in transmembrane domains and the N-terminus region, which have been shown to be crucial for MC1R function in other species . Prioritize positions that show evidence of selection or that differ between populations with distinct pigmentation patterns.

  • Design mutagenesis strategy: Create multiple mutant constructs with single amino acid substitutions to isolate the effect of each residue. Additionally, create combination mutants to assess potential synergistic effects between residues .

  • Functional characterization pipeline:

    • Measure total receptor expression to ensure mutations don't simply affect protein stability

    • Assess cell surface expression to determine if trafficking is affected

    • Evaluate cAMP signaling in response to α-MSH stimulation

    • Compare EC50 values and maximum response (Emax) between mutants

  • Correlation with natural variants: Compare the functional effects of engineered mutations with naturally occurring variants observed in wild Cercopithecus diana populations with different pigmentation patterns .

A systematic approach for investigating transmembrane domains should include creating chimeric receptors between Cercopithecus diana MC1R and well-characterized MC1R from model organisms, followed by sequential replacement of individual amino acids to pinpoint specific functional residues .

What are the optimal conditions for transfection and expression of recombinant Cercopithecus diana MC1R?

Optimizing transfection and expression conditions is critical for obtaining reliable functional data on recombinant Cercopithecus diana MC1R. Based on established protocols for MC1R studies, the following parameters should be fine-tuned:

  • Expression vector selection: The mammalian expression vector pcDps with N-terminal hemagglutinin (HA) and C-terminal flag epitope tags has proven effective for MC1R expression studies . These tags allow for monitoring both total expression and cell surface localization.

  • Transfection optimization:

    • Cell density: Seed COS-7 cells at 70-80% confluence for optimal transfection efficiency

    • DNA:lipid ratio: Test various ratios of plasmid DNA to LipoFiter Liposomal Transfection Reagent (or alternative transfection reagent)

    • Incubation time: Typically 24-48 hours post-transfection before functional assays

    • Transfection verification: Include GFP-based control plasmid to monitor transfection efficiency

  • Expression conditions:

    • Culture in DMEM with 10% FBS at 37°C in humidified 5% CO2 incubator

    • Harvest cells at optimal time point (usually 48 hours post-transfection) for maximum expression

    • Verify expression through Western blot and immunofluorescence using tag-specific antibodies

  • Functional assay optimization:

    • Determine optimal cell density and α-MSH concentration range

    • Include positive controls (known functional MC1R variants) and negative controls (untransfected cells)

    • Normalize cAMP measurements to cell surface expression levels for accurate comparison between variants

How do functional assays of recombinant Cercopithecus diana MC1R compare to those used for other primate MC1R receptors?

Functional characterization approaches for Cercopithecus diana MC1R would largely mirror methodologies established for other primate MC1R studies, with some species-specific considerations:

  • Signal transduction assessment: Similar to studies in other species, measuring agonist-induced cAMP formation provides the most direct assessment of MC1R function. Cells expressing Cercopithecus diana MC1R would be expected to respond to α-MSH with increased intracellular cAMP levels, though the magnitude of response may vary based on receptor sequence and expression levels .

  • Comparative analyses: When evaluating different Cercopithecus diana MC1R variants, researchers should quantify:

    • Total receptor protein expression

    • Cell-surface expression level

    • Dose-dependent cAMP response to α-MSH stimulation

    This multi-parameter approach allows distinguishing between defects in protein expression, trafficking, and signaling capacity .

  • Species-specific considerations:

    • Given the distinctive coloration pattern of Diana monkeys, with specific regions of black, white, and red-brown/orange pigmentation , functional assays should assess potential region-specific MC1R variants that might contribute to this patterning.

    • Compare receptor functionality across closely related Cercopithecus species with different pigmentation patterns to identify convergent or divergent evolutionary mechanisms.

  • Phylogenetic context: Interpret functional differences in the context of phylogenetic relationships among primate MC1R sequences, particularly focusing on primates with diverse pigmentation patterns .

What methodology should be used to analyze associations between MC1R variants and pigmentation patterns in Cercopithecus diana populations?

A comprehensive methodology for analyzing associations between MC1R variants and pigmentation in Cercopithecus diana populations would involve:

  • Sampling strategy:

    • Collect samples from multiple populations across the species' range (Sierra Leone to Ghana)

    • Document precise pigmentation patterns with standardized photography

    • Measure pigmentation objectively using spectrophotometry to quantify luminance values for different body regions

    • Record environmental parameters (elevation, temperature, humidity, insolation) for each collection site

  • Genetic analysis:

    • Sequence the complete coding sequence (CDS) of the MC1R gene from all sampled individuals

    • Identify single-nucleotide polymorphisms (SNPs) and categorize them as synonymous or nonsynonymous

    • Assess potential functional impact of nonsynonymous variants using bioinformatic prediction tools (SIFT, PolyPhen)

  • Statistical approaches:

    • Implement logistic regression models to determine odds ratios (OR) for associations between specific variants and pigmentation phenotypes

    • Apply minimum redundancy maximum relevance (mRMR) algorithm to identify the most informative MC1R variants

    • Test for outlier SNPs relative to general population structuring to identify candidates potentially under selection

    • Control for phylogenetic relationships to distinguish selection from neutral evolutionary processes

  • Functional validation:

    • Select representative MC1R alleles from populations with distinct pigmentation patterns

    • Express these alleles in cell culture systems and compare functional parameters

    • Correlate functional differences with observed pigmentation variation

How can researchers distinguish between MC1R-mediated and other genetic influences on pigmentation in Cercopithecus diana?

Distinguishing MC1R-mediated from other genetic influences on Cercopithecus diana pigmentation requires a multi-faceted approach:

  • Genome-wide association studies (GWAS):

    • Compare MC1R associations with those of other pigmentation-related genes (e.g., ASIP, TYR, TYRP1, DCT)

    • Quantify the relative contribution of MC1R variants versus other loci to pigmentation variation

    • Identify potential epistatic interactions between MC1R and other genes

  • Transcriptomic analysis:

    • Compare gene expression profiles in differently pigmented skin/hair regions

    • Identify co-expression networks involving MC1R and other pigmentation genes

    • Analyze differential expression in response to environmental factors

  • Experimental validation:

    • Develop in vitro models that incorporate multiple components of the melanin synthesis pathway

    • Test the effects of manipulating MC1R alongside other pathway components

    • Use CRISPR/Cas9 or similar technologies in appropriate cell models to make specific genetic changes while controlling for genetic background

  • Comparative analysis across primate species:

    • Examine convergent evolution of pigmentation patterns across species

    • Compare the relative contribution of MC1R versus other genes to similar pigmentation patterns in different primate lineages

    • Use phylogenetic comparative methods to identify shifts in selective pressures on different pigmentation genes

The table below outlines a comparison of expected effects for MC1R-mediated versus other genetic influences on pigmentation:

What are the challenges in isolating and purifying recombinant Cercopithecus diana MC1R protein?

Isolating and purifying MC1R presents significant technical challenges due to its seven transmembrane domain structure and membrane-embedded nature. For Cercopithecus diana MC1R, specific considerations include:

  • Protein solubilization:

    • MC1R is a hydrophobic integral membrane protein requiring careful detergent selection

    • Test multiple detergents (DDM, CHAPS, digitonin) at various concentrations to identify optimal solubilization conditions while preserving protein structure

    • Consider using styrene maleic acid lipid particles (SMALPs) to extract MC1R with its native lipid environment intact

  • Expression system optimization:

    • COS-7 cells provide a primate-derived system suitable for Cercopithecus diana MC1R expression

    • Insect cell systems (Sf9, High Five) may provide higher expression levels but with potentially different post-translational modifications

    • Consider stable cell lines for larger-scale production rather than transient transfection

  • Purification strategy:

    • Utilize epitope tags (N-terminal HA and C-terminal FLAG) for affinity purification

    • Implement two-step purification: initial affinity chromatography followed by size-exclusion chromatography

    • Include appropriate protease inhibitors throughout to prevent degradation

    • Maintain careful temperature control (typically 4°C) during all purification steps

  • Functional verification:

    • Verify that purified receptor retains α-MSH binding capacity

    • Confirm structural integrity through circular dichroism spectroscopy

    • Consider reconstitution into liposomes or nanodiscs for functional studies

The multi-step approach below outlines a systematic purification strategy:

  • Transfect COS-7 cells with tagged Cercopithecus diana MC1R construct

  • Harvest cells 48-72 hours post-transfection

  • Solubilize membrane fraction with optimized detergent mixture

  • Perform affinity purification using anti-HA or anti-FLAG resins

  • Apply size-exclusion chromatography to remove aggregates

  • Verify purity by SDS-PAGE and Western blotting

  • Confirm functionality through ligand binding assays

How can researchers accurately quantify expression levels and localization of recombinant Cercopithecus diana MC1R?

Accurate quantification of expression levels and subcellular localization is essential for interpreting functional data from recombinant Cercopithecus diana MC1R studies. Multiple complementary approaches should be employed:

  • Total protein expression quantification:

    • Western blotting using antibodies against epitope tags (HA, FLAG) with appropriate standard curves

    • ELISA-based approaches for more precise quantification

    • Consider stable isotope labeling (SILAC) for mass spectrometry-based comparative quantification between variants

  • Cell surface expression analysis:

    • Flow cytometry using antibodies against N-terminal epitope tags or extracellular domains

    • Cell-surface biotinylation followed by streptavidin pull-down and Western blotting

    • ELISA-based assays on non-permeabilized cells

  • Subcellular localization assessment:

    • Immunofluorescence microscopy with co-localization markers for different cellular compartments

    • Confocal microscopy for detailed visualization of membrane vs. intracellular distribution

    • Time-course analysis to track receptor trafficking from synthesis to membrane

  • Quantitative analysis approaches:

    • Calculate the ratio of cell-surface to total expression to normalize for transfection efficiency

    • Implement automated image analysis for consistent quantification across samples

    • Use reference standards across experiments for inter-experimental comparability

This multi-parameter approach allows researchers to distinguish between variants that affect protein stability, trafficking, or signaling capacity, providing a more complete understanding of how sequence variations impact receptor function .

What is the recommended protocol for studying ligand-receptor interactions for Cercopithecus diana MC1R?

A comprehensive protocol for studying ligand-receptor interactions for Cercopithecus diana MC1R should include both binding and functional assays:

  • Radioligand binding assays:

    • Use [125I]-labeled α-MSH or NDP-α-MSH (a more stable analog)

    • Perform saturation binding experiments to determine Bmax (receptor density) and Kd (binding affinity)

    • Conduct competition binding experiments with unlabeled ligands to determine Ki values

    • Compare binding parameters between different Cercopithecus diana MC1R variants

  • Functional response assays:

    • Measure cAMP accumulation in response to increasing concentrations of α-MSH

    • Generate dose-response curves to determine EC50 values and maximum response (Emax)

    • Compare response kinetics (time course of cAMP accumulation)

    • Assess potential biased signaling through complementary assays (β-arrestin recruitment, ERK activation)

  • Real-time binding analysis:

    • Implement surface plasmon resonance (SPR) or biolayer interferometry (BLI) for label-free, real-time binding kinetics

    • Determine association (kon) and dissociation (koff) rate constants

    • Calculate binding affinity (KD = koff/kon) and compare with radioligand binding results

  • Structure-activity relationship studies:

    • Test α-MSH analogs with specific modifications to map the binding interface

    • Compare binding and signaling profiles of natural ligands (α-MSH, ACTH, β-MSH) and synthetic agonists

    • Investigate potential species-specific differences in ligand recognition between Cercopithecus diana MC1R and other primate MC1Rs

The experimental design should include appropriate controls (untransfected cells, cells expressing known functional/non-functional MC1R variants) and normalization for receptor expression levels to enable accurate interpretation of results .

How should researchers interpret conflicting data between in vitro MC1R functional assays and observed pigmentation phenotypes?

Discrepancies between in vitro functional data and observed pigmentation phenotypes represent a common challenge in MC1R research. Researchers studying Cercopithecus diana MC1R should consider the following interpretative framework:

  • Biological complexity considerations:

    • In vivo pigmentation results from complex interactions between multiple genetic and environmental factors

    • MC1R functions within a signaling network that includes antagonistic regulators like ASIP (Agouti)

    • Pigmentation patterning may involve region-specific expression of MC1R and/or other pathway components

  • Methodological factors:

    • In vitro expression systems may lack primate-specific co-factors or post-translational modifications

    • Standard assays measure only cAMP signaling, potentially missing alternative signaling pathways

    • Expression levels in heterologous systems may not reflect natural expression in melanocytes

  • Reconciliation approaches:

    • Develop more sophisticated in vitro models incorporating multiple components of the melanin synthesis pathway

    • Measure multiple functional parameters (binding affinity, surface expression, signaling efficacy) to create a comprehensive functional profile

    • Consider the possibility of biased signaling, where receptors may preferentially activate different downstream pathways

  • Integrative analysis:

    • Combine genetic association data with functional characterization

    • Assess epistatic interactions between MC1R and other pigmentation genes

    • Consider environmental factors that may modulate MC1R function in vivo

    • Implement statistical approaches that integrate multiple data types to build predictive models

When confronted with conflicting data, researchers should prioritize replication in independent experimental systems and consider moving beyond simple in vitro models to more complex cellular or organotypic systems that better recapitulate the in vivo melanocyte environment.

What emerging technologies could advance our understanding of Cercopithecus diana MC1R function and evolution?

Several cutting-edge technologies hold promise for advancing research on Cercopithecus diana MC1R:

  • Cryo-electron microscopy (Cryo-EM):

    • Determine high-resolution structures of Cercopithecus diana MC1R in different conformational states

    • Compare structural details with MC1R from other species to identify evolutionary adaptations

    • Map the binding interface between the receptor and its natural ligands

  • Single-cell transcriptomics:

    • Profile gene expression in individual melanocytes from differently pigmented regions of Cercopithecus diana

    • Identify co-expression networks involving MC1R and other pigmentation genes

    • Discover potential region-specific regulatory mechanisms that contribute to the distinctive pigmentation pattern

  • CRISPR/Cas9 genome editing:

    • Create precise MC1R variants in relevant cell models

    • Test the functional consequences of naturally occurring variations

    • Develop potential primate cell lines that more accurately reflect Cercopithecus diana melanocytes

  • Computational approaches:

    • Implement molecular dynamics simulations to model receptor-ligand interactions and conformational changes

    • Apply machine learning algorithms to predict functional consequences of MC1R variants

    • Develop evolutionary models that integrate molecular, phenotypic, and environmental data

  • Organoid technology:

    • Develop skin organoids that incorporate melanocytes expressing Cercopithecus diana MC1R

    • Create more physiologically relevant models for studying pigmentation biology

    • Test environmental factors that might modulate MC1R function in a tissue-like context

These technologies could help bridge the gap between molecular mechanisms and organismal phenotypes, providing deeper insights into how MC1R variation contributes to the distinctive pigmentation patterns in Cercopithecus diana.

How can evolutionary analysis of MC1R across primate species inform functional studies of Cercopithecus diana MC1R?

Evolutionary analysis provides a powerful framework for interpreting functional studies of Cercopithecus diana MC1R:

  • Comparative sequence analysis:

    • Identify conserved regions likely essential for core receptor function

    • Detect lineage-specific accelerated evolution suggesting adaptive changes

    • Compare patterns of variation in MC1R across primates with different pigmentation patterns

  • Selection analysis:

    • Test for signatures of positive selection, purifying selection, or relaxed constraints

    • Identify specific codons under selection in the Cercopithecus diana lineage

    • Compare selection patterns with those in other primate lineages with distinctive pigmentation

  • Ancestral sequence reconstruction:

    • Infer ancestral MC1R sequences at key nodes in primate phylogeny

    • Express and functionally characterize reconstructed ancestral receptors

    • Map the functional trajectory of MC1R evolution leading to Cercopithecus diana

  • Structure-function mapping:

    • Use evolutionary conservation patterns to predict functional importance of specific residues

    • Focus functional studies on sites showing unusual patterns of evolution

    • Integrate evolutionary data with structural models to predict how substitutions affect receptor function

  • Ecological correlations:

    • Analyze correlations between MC1R sequence evolution and ecological factors across primates

    • Test whether similar pigmentation patterns in different primate lineages involve convergent MC1R evolution

    • Consider how the forest habitat of Cercopithecus diana might influence selection on pigmentation genes

By placing Cercopithecus diana MC1R in its proper evolutionary context, researchers can develop more informed hypotheses about which sequence variations are likely to have functional significance and how these variations might contribute to the species' distinctive pigmentation pattern.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.