Recombinant Cercopithecus neglectus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling any special requirements you may have. Please specify your desired format in the order notes, and we will strive to accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Cercopithecus neglectus (De Brazza's monkey)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTAPPHLGLAANQTGTRCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYIHMLARACQHAQGIARLHKRQCPAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor acts as a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the process of producing eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling within melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for recombinant Cercopithecus neglectus MC1R?

For optimal stability and activity, recombinant Cercopithecus neglectus MC1R should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity and functionality . For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . The protein should be handled on ice when preparing experimental samples to prevent degradation, and sterile techniques should be employed to avoid contamination.

How does MC1R oligomerization affect its functionality in experimental settings?

MC1R undergoes constitutive dimerization without requiring ligand binding, which occurs at the level of the endoplasmic reticulum . This dimerization is dependent on both covalent and non-covalent interactions, mediated by four inter-subunit disulfide bonds at positions C35, C267, C273, and C275 . The oligomerization state significantly impacts:

  • Ligand binding efficiency

  • G-protein coupling

  • Desensitization kinetics

  • Intracellular trafficking

Importantly, disruption of any disulfide bond abolishes MC1R function, but only C35 is essential for translocation from the ER to the plasma membrane . When designing experiments, researchers should consider that heterogeneous receptor dimerization (e.g., between wild-type and mutant receptors) can produce dominant negative effects, potentially confounding experimental results . Conversely, co-expression of two mutant receptors with mutations in different domains may partially rescue function through complementation, although this rescue does not occur if mutations are in the same domain .

What signaling pathways are activated by Cercopithecus neglectus MC1R and how can they be experimentally measured?

The MC1R signals primarily through the Gαs protein-adenylyl cyclase-cAMP pathway. Upon agonist binding:

  • The Gαs protein dissociates from MC1R

  • Adenylyl cyclase is stimulated, cleaving ATP to generate cAMP

  • Elevated cAMP activates downstream effectors, primarily protein kinase A (PKA)

  • PKA initiates various signaling cascades within the cell

These pathways can be experimentally measured using:

TechniqueParameter MeasuredAdvantagesLimitations
ELISA-based cAMP assaysIntracellular cAMP levelsHigh sensitivity, quantitativeEndpoint measurement only
FRET-based cAMP sensorsReal-time cAMP dynamicsSpatial and temporal resolutionRequires cell transfection
PKA activity assaysPhosphorylation of PKA substratesDirectly measures pathway activationPotential off-target effects
Phospho-specific antibodiesActivation of downstream effectorsCan track specific nodes in pathwayLimited to known phosphorylation sites
RNA-seq/qPCRTranscriptional responsesComprehensive pathway outputsSecondary effects difficult to distinguish

MC1R exhibits some degree of ligand-independent basal signaling, which should be accounted for in experimental design by including appropriate controls .

How does MC1R interact with melanocortins, agouti signaling protein (ASIP), and β-defensin 3 (βD3), and how can these interactions be studied?

MC1R signaling is modulated by three main types of ligands with distinct effects:

  • Melanocortins (e.g., α-MSH): Function as agonists, enhancing MC1R signaling and increasing cAMP levels

  • Agouti signaling protein (ASIP): Acts as an inverse agonist, inhibiting MC1R signaling directly and decreasing basal cAMP levels

  • β-defensin 3 (βD3): Functions as a neutral antagonist, not affecting basal cAMP levels but competing with both α-MSH and ASIP for binding to MC1R

These interactions can be studied using:

  • Competitive binding assays: Using radiolabeled or fluorescently labeled ligands to assess binding affinities and competition between different ligands

  • BRET/FRET assays: To measure direct protein-protein interactions and conformational changes

  • Functional signaling assays: Measuring cAMP production in response to various combinations and concentrations of ligands

  • Co-immunoprecipitation: To identify protein complexes and interaction partners

  • Surface plasmon resonance: For detailed kinetic analysis of binding interactions

ASIP requires two major accessory proteins for full functionality: attractin (encoded by the Atrn gene) and mahogunin (encoded by the Mgrn1 gene) . These should be considered when designing experiments to study ASIP-MC1R interactions.

What is the mechanistic connection between MC1R signaling and nucleotide excision repair (NER)?

MC1R activation enhances nucleotide excision repair (NER) through multiple distinct mechanisms:

  • XPC and γH2AX upregulation: MC1R signaling increases levels of XPC and γH2AX, promoting the formation of DNA repair complexes

  • ATR phosphorylation: PKA activation promotes phosphorylation of ATR at S435, which then complexes with XPA in the nucleus

  • XPA-ATR translocation: Following phosphorylation, the XPA-ATR complex translocates to sites of UV-induced DNA damage

  • p53 signaling: MC1R activation promotes phosphorylation of p53 at S15 in an ATR and DNA-PK dependent manner, activating wild-type p53 induced phosphatase 1 and leading to γH2AX degradation

  • NR4A2 translocation: MC1R activation induces translocation of NR4A2 to the nucleus in a p38 and PARP1 dependent manner, where it co-localizes with XPC and XPE at sites of UV-induced damage

These mechanisms collectively accelerate and enhance NER, independent of pigmentation effects, reducing the persistence of UV photodamage in melanocytes .

How can the effects of MC1R on DNA repair be experimentally quantified?

The effects of MC1R on DNA repair can be quantified using multiple complementary approaches:

When designing these experiments, it's crucial to include appropriate controls that distinguish between MC1R-dependent and MC1R-independent repair pathways. Using MC1R agonists (α-MSH), antagonists (βD3), or inverse agonists (ASIP) can help delineate the specific contribution of MC1R signaling to the repair process .

What evolutionary insights can be gained from studying Cercopithecus neglectus MC1R compared to other primate MC1Rs?

Studying Cercopithecus neglectus MC1R in comparison to other primate MC1Rs provides valuable insights into:

  • Functional conservation: The fundamental signaling mechanisms of MC1R appear conserved across primates, including activation of adenylyl cyclase and cAMP production

  • Adaptive evolution: Variations in MC1R sequence between primate species may reflect adaptation to different environmental UV exposures and selective pressures

  • Ligand specificity: Different primate MC1Rs may exhibit varied responses to melanocortins, ASIP, and βD3, reflecting species-specific regulatory mechanisms

  • Polymorphism patterns: Unlike human MC1R, which is highly polymorphic and associated with pigmentation variation , the degree of polymorphism in Cercopithecus neglectus MC1R may reveal different evolutionary constraints

Comparative studies should include:

  • Sequence alignment analyses identifying conserved and divergent regions

  • Functional assays comparing ligand binding properties

  • Signaling efficiency comparisons across primate MC1Rs

  • Assessment of dimerization properties between different primate MC1Rs

These analyses can illuminate how MC1R function has evolved in response to specific environmental and ecological factors across the primate lineage.

What are the optimal expression systems for producing functional recombinant Cercopithecus neglectus MC1R for research applications?

The choice of expression system for recombinant Cercopithecus neglectus MC1R production depends on the experimental requirements:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effective, rapidLimited post-translational modifications, potential improper folding of membrane proteinsStructural studies requiring high protein amounts
Insect cells (Sf9, Sf21)Better folding of membrane proteins, some post-translational modificationsMore expensive than bacterial systems, moderate yieldFunctional studies requiring properly folded protein
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, proper foldingLower yields, expensive, time-consumingSignaling studies, interaction studies requiring authentic modifications
Cell-free systemsRapid, avoids toxicity issuesExpensive, limited scalabilitySmall-scale screening, proteins toxic to living cells
Yeast (P. pastoris)High yield, eukaryotic folding machineryDifferent glycosylation patternsLarge-scale production for biochemical studies

For optimizing expression, consider:

  • Adding stabilizing tags (His, GST, MBP) for purification and stability

  • Using inducible promoters to control expression timing

  • Including chaperones to enhance proper folding

  • Optimizing codon usage for the host organism

  • Adding visualization tags (GFP, YFP) for localization studies when appropriate

The choice of tag type may be determined during the production process based on protein behavior and experimental needs .

How can binding affinity and signaling properties of different ligands be accurately compared for Cercopithecus neglectus MC1R?

To accurately compare binding affinity and signaling properties of different ligands for Cercopithecus neglectus MC1R:

  • Binding affinity determination:

    • Saturation binding assays with radiolabeled or fluorescently labeled ligands

    • Competition binding assays to determine relative affinities of unlabeled ligands

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Signaling property assessment:

    • Dose-response curves for cAMP production to determine EC50 values

    • Bioluminescence resonance energy transfer (BRET) assays to monitor receptor-G protein interactions

    • Arrestin recruitment assays to assess receptor desensitization

    • Calcium flux assays for Gq-coupled signaling (if applicable)

    • ERK phosphorylation assays for MAPK pathway activation

  • Experimental design considerations:

    • Use multiple concentrations spanning at least 4 log units around the expected EC50/IC50

    • Include positive controls (known agonists like α-MSH) and negative controls

    • Standardize expression levels across experiments using quantitative Western blotting

    • Account for potential species differences in ligand recognition

    • Consider the effects of receptor dimerization on signaling properties

  • Data analysis approaches:

    • Fit binding data to appropriate models (one-site, two-site, allosteric)

    • Calculate binding parameters (Kd, Bmax) and signaling parameters (EC50, Emax)

    • Use Schild analysis for competitive antagonists

    • Apply operational models for partial agonists and allosteric modulators

These methods enable robust comparison of how different ligands (melanocortins, ASIP, βD3) interact with and modulate Cercopithecus neglectus MC1R activity.

How can Cercopithecus neglectus MC1R be utilized to understand melanoma pathogenesis and potential therapeutic approaches?

Cercopithecus neglectus MC1R serves as a valuable comparative model for understanding melanoma pathogenesis:

  • Comparative genomic studies: Comparing monkey and human MC1R variants can identify conserved regions critical for function and mutations associated with melanoma risk

  • UV response modeling: Since MC1R regulates UV responses and DNA repair, comparing how different primate MC1Rs respond to UV can illuminate evolutionary adaptations in DNA repair mechanisms

  • Signaling pathway conservation: Investigating whether the link between MC1R, cAMP signaling, and nucleotide excision repair is conserved across primates can identify essential protective pathways

  • Therapeutic target identification:

    • Screening compounds for their ability to rescue defective MC1R signaling

    • Identifying downstream components of the MC1R pathway that could be targeted therapeutically

    • Testing whether bypassing MC1R to directly activate cAMP signaling protects against UV damage

  • Experimental approaches:

    • CRISPR/Cas9 to introduce human MC1R variants into primate cell lines

    • Comparative analysis of DNA repair kinetics following UV exposure

    • Drug screening platforms using cells expressing various MC1R variants

    • Proteomics to identify species-specific MC1R interaction partners

The MC1R-cAMP signaling axis represents a critical innate UV-protective mechanism, and leveraging comparative studies with Cercopithecus neglectus MC1R can inform therapeutic strategies aimed at enhancing genomic stability in melanocytes .

What insights about MC1R polymorphisms and skin cancer risk can be gained from studying Cercopithecus neglectus MC1R?

Studying Cercopithecus neglectus MC1R provides valuable comparative insights into MC1R polymorphisms and skin cancer risk:

  • Evolutionary conservation analysis: Identifying which regions of MC1R are conserved across primates can highlight functionally critical domains where polymorphisms would likely be deleterious

  • Natural variation assessment: While human MC1R is highly polymorphic with variants associated with fair skin and increased melanoma risk , analyzing natural variation in Cercopithecus neglectus MC1R can reveal which regions tolerate variation versus those under strict evolutionary constraint

  • Functional domain mapping: Comparing the effects of polymorphisms in equivalent positions across primate MC1Rs can map functional domains critical for:

    • Ligand binding

    • G-protein coupling

    • Dimerization

    • DNA repair signaling

  • Research methodologies:

    • Pooled genetic analysis similar to the M-SKIP project (Melanocortin-1 receptor, SKin cancer and Phenotypic characteristics)

    • Site-directed mutagenesis to introduce equivalent polymorphisms across species

    • Functional assays comparing wild-type and variant receptors

    • Computational modeling of variant effects on protein structure

  • Translational implications: Understanding how specific MC1R domains contribute to DNA repair and genomic stability can inform risk assessment for human MC1R variants and potentially lead to personalized prevention strategies

Since melanoma has one of the highest somatic mutational loads among human tumors and MC1R-defective individuals lack the DNA repair "boost" from an effective melanocortin-MC1R axis, comparative studies can illuminate how variants impact UV mutagenesis over time .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.