Recombinant Cerrophidion godmani NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. We recommend contacting your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we suggest centrifuging the vial briefly to ensure the contents settle to the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type preference, please inform us, and we will endeavor to incorporate it.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Cerrophidion godmani (Porthidium godmani) (Bothrops godmani)
Target Names
Target Protein Sequence
PIAGSMVLAAVLLKLGGYGIIRMMQTLPTTKTDMFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMTTTWWLLANLMNIATPPTLNFTSELLIMSTLFNWCPTTIILLGLSMLIT ASYSLHMFLSTQMGPTLLNNQTEPMHSREHLLMALHLVPLMMISMKPELII
Uniprot No.

Target Background

Function
This protein serves as a core subunit within the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be a crucial component of the minimal assembly required for catalytic activity. Complex I plays a vital role in transferring electrons from NADH to the respiratory chain. The primary electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What are the optimal methods for amplifying MT-ND4 from Cerrophidion godmani samples?

Based on established protocols for mitochondrial gene amplification, researchers should consider a multiplex PCR approach targeting the MT-ND4 region. For optimal results:

  • Extract total DNA using a Qiagen DNeasy extraction kit from tissue samples (preferably muscle tissue) .

  • Design primers flanking the MT-ND4 gene region, similar to approaches used for other species.

  • Use PCR conditions similar to those established for amplification of mitochondrial fragments: GoTaq Green master mix with annealing temperatures around 48°C .

  • Consider a triplex real-time PCR approach that allows simultaneous amplification of MT-ND4 along with a conserved region (such as D-Loop) as an internal control .

Researchers should note that successful amplification typically uses forward primers in the range of 5'-TGTAAAACTGCGGCCGCTCTCCCTCTACATATTTACCAC-3' and reverse primers such as 5'-CATGCGGCCGCTATGACCGTGGCTCAGTGTCAGTTCG-3', though these should be optimized for Cerrophidion godmani specifically .

How can I confirm the phylogenetic identity of my Cerrophidion godmani samples before MT-ND4 isolation?

Given the cryptic diversity within Cerrophidion godmani revealed by molecular studies, proper identification is critical:

  • Sequence multiple mitochondrial markers including ND4, cytochrome b, 12S rRNA, and 16S rRNA .

  • Compare sequences against reference databases, particularly noting that C. godmani represents three deeply divergent lineages as established by Jadin et al. .

  • Include morphological confirmation using diagnostic characters such as:

    • Count of interrictals (which differ among the three distinct Cerrophidion lineages)

    • Geographic origin (Guatemala/Mexico vs. Honduras/El Salvador vs. Costa Rica) .

This identification step is crucial as using misidentified specimens could introduce significant error into subsequent MT-ND4 analysis.

What expression systems are most effective for producing recombinant MT-ND4 protein?

For recombinant expression of mitochondrial proteins such as MT-ND4:

  • Initial cloning: The MT-ND4 gene should be PCR-amplified and cloned into an appropriate expression vector (such as pcDNA3.1(+)) .

  • Expression systems:

    • Bacterial systems (E. coli): Suitable for initial screening but may require codon optimization and often produce inclusion bodies requiring refolding.

    • Eukaryotic systems: Recommended for functional studies, with HEK293 or CHO cells providing better post-translational modifications.

    • Cell-free systems: Consider for proteins that may be toxic to host cells.

  • Purification strategy:

    • His-tag purification is commonly effective for initial isolation

    • Size exclusion chromatography for further purification

    • Consider detergent screening for optimal solubilization of this membrane protein

Note that as a highly hydrophobic mitochondrial membrane protein, special considerations for membrane protein expression should be applied .

How can cryo-EM techniques be applied to study the structure of MT-ND4 from Cerrophidion godmani?

Cryo-EM represents a powerful approach for structural studies of membrane proteins like MT-ND4:

  • Sample preparation:

    • Purify the recombinant protein in detergent micelles or reconstitute into nanodiscs

    • Optimize buffer conditions to prevent aggregation (typically 20 mM HEPES pH 7.4, 150 mM NaCl)

    • Apply 3-4 μl of sample to glow-discharged grids

  • Data collection parameters:

    • Collect micrographs at 300 kV with a direct electron detector

    • Use dose fractionation (40-50 e-/Å2 total exposure)

    • Defocus range of -0.8 to -2.5 μm

  • Processing workflow:

    • Motion correction and CTF estimation

    • Particle picking, 2D classification, and 3D refinement

    • Focus on regions showing structural flexibility, as seen in related Na+-NQR structural studies

The flexibility of certain regions, particularly transmembrane helices and the N-terminal stretch, may present challenges similar to those observed in related complex I structures .

What approaches can resolve potential structure-function relationships in Cerrophidion godmani MT-ND4 compared to human MT-ND4?

A comprehensive comparative analysis should include:

  • Sequence alignment analysis:

    • Align snake MT-ND4 with human MT-ND4 and other vertebrates

    • Identify conserved functional domains and species-specific variations

    • Pay particular attention to regions associated with pathogenic mutations in humans, such as position 340 (Arg340His) implicated in Leber hereditary optic neuropathy

  • Molecular dynamics simulations:

    • Model the protein in a lipid bilayer environment

    • Simulate electron transfer pathways

    • Assess potential differences in proton pumping efficiency

  • Site-directed mutagenesis:

    • Target conserved residues to assess functional importance

    • Examine species-specific residues that might confer adaptive advantages

    • Systematically test positions known to harbor disease-causing mutations in humans

  • Functional assays:

    • Measure electron transfer rates from NADH to ubiquinone

    • Assess membrane potential generation

    • Compare enzyme kinetics between snake and human variants

This comparative approach can yield insights into evolutionary adaptations and potential biomedical applications .

How can phylogenetic analysis of MT-ND4 inform our understanding of Cerrophidion godmani speciation?

The MT-ND4 gene has proven valuable for resolving phylogenetic relationships:

  • Sampling strategy:

    • Collect specimens from across the geographic range (Guatemala/Mexico, Honduras/El Salvador, and Costa Rica)

    • Include all three cryptic lineages identified by Jadin et al.

    • Add outgroups including C. petlalcalensis and C. tzotzilorum

  • Analysis methods:

    • Implement Bayesian MCMC analyses using appropriate substitution models

    • Partition data by gene and codon position

    • Apply divergence dating techniques to estimate lineage separation times

  • Interpretation framework:

    • Compare MT-ND4 gene trees with other mitochondrial markers

    • Integrate with nuclear markers to account for potential mitochondrial introgression

    • Correlate genetic divergence with geographical barriers in Central America

This approach has previously revealed that C. godmani represents three distinct lineages with divergence dates approaching 10 million years, demonstrating the power of MT-ND4 in resolving cryptic diversity .

What strategies can address the challenges of heterologous expression of a highly hydrophobic membrane protein like MT-ND4?

Membrane proteins like MT-ND4 present specific challenges:

  • Solubilization strategies:

    • Screen multiple detergents (DDM, LMNG, GDN)

    • Test detergent:protein ratios systematically

    • Consider amphipols or SMALPs for detergent-free approaches

  • Expression optimization:

    • Test expression at lower temperatures (16-25°C)

    • Use specialized E. coli strains (C41(DE3), C43(DE3)) designed for membrane proteins

    • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Refolding protocols:

    • If inclusion bodies form, develop a refolding protocol using gradual dialysis

    • Test different redox conditions during refolding

    • Incorporate lipids during the refolding process

  • Activity verification:

    • Develop assays to confirm proper folding through activity measurements

    • Consider reconstitution into proteoliposomes for functional studies

These approaches have been successful with related complex I components and can be adapted for MT-ND4 .

How can researchers optimize triplex real-time PCR to accurately quantify MT-ND4 gene content in Cerrophidion godmani samples?

Based on established methodologies:

  • Primer and probe design:

    • Design MT-ND4 primers that avoid regions with common SNPs

    • Include a conserved mitochondrial marker (MT-ND1) that is rarely deleted

    • Add a third marker (D-Loop) as an internal control

  • Validation protocol:

    • Test primers in both singleplex and triplex conditions

    • Create standard curves with serial dilutions of a plasmid containing all three targets

    • Calculate and compare amplification efficiencies between singleplex and triplex conditions

  • Data analysis:

    • Calculate ratios of MT-ND4/D-Loop and MT-ND4/MT-ND1

    • Use standard curves for absolute quantification

    • Implement appropriate statistical analyses for replicate samples

  • Controls:

    • Include no-template controls

    • Develop positive controls using cloned target sequences

    • Prepare samples with known deletion ratios as reference standards

This approach allows accurate quantification of MT-ND4 gene content and can detect potential deletions or copy number variations .

What methodological considerations are important when comparing MT-ND4 sequences across different Cerrophidion populations?

For robust comparative analyses:

  • Sampling design:

    • Include multiple specimens from each geographic region

    • Sample across environmental gradients

    • Consider temporal sampling to assess potential evolutionary changes

  • Sequence quality control:

    • Sequence both strands for verification

    • Implement stringent base-calling thresholds

    • Check for potential nuclear mitochondrial pseudogenes (NUMTs)

  • Alignment considerations:

    • Use appropriate alignment algorithms for coding sequences

    • Check for reading frame preservation

    • Verify start/stop codons and potential RNA editing sites

  • Analytical approaches:

    • Calculate appropriate genetic distance metrics

    • Test for selection using dN/dS ratios

    • Implement population genetic analyses to detect potential adaptive signatures

Previous studies have shown significant genetic structure within Guatemala/Mexico and Honduras/El Salvador populations, which should be accounted for in any comparative analysis .

How should researchers interpret apparent conflicts between MT-ND4 gene trees and morphological data in Cerrophidion godmani?

When faced with incongruence between genetic and morphological datasets:

  • Systematic approach to resolution:

    • Verify data quality for both datasets

    • Test for incomplete lineage sorting using coalescent-based methods

    • Consider the potential for hybridization or introgression

  • Analytical frameworks:

    • Implement total evidence approaches combining morphological and molecular data

    • Use Bayesian species delimitation methods

    • Apply multivariate morphometric analyses to quantify morphological variation

  • Interpretation guidelines:

    • Recognize that molecular evolution may proceed at different rates than morphological evolution

    • Consider that selective pressures on MT-ND4 may differ from those on morphological traits

    • Evaluate the role of environmental factors in driving convergent morphological evolution

The Cerrophidion complex exemplifies cryptic speciation where deep molecular divergence (approaching 10 million years) may be accompanied by subtle morphological differentiation, requiring careful integration of multiple data types .

What statistical approaches are most appropriate for analyzing site-directed mutagenesis data of MT-ND4?

For rigorous analysis of mutagenesis experiments:

  • Experimental design considerations:

    • Include technical and biological replicates

    • Incorporate appropriate positive and negative controls

    • Use wild-type protein as a reference standard

  • Statistical methods:

    • Apply ANOVA with post-hoc tests for multi-group comparisons

    • Use non-parametric tests when assumptions of normality are violated

    • Implement mixed-effects models when dealing with nested experimental designs

  • Effect size quantification:

    • Calculate fold-changes relative to wild-type

    • Determine IC50/EC50 values for dose-response experiments

    • Quantify kinetic parameters (Km, Vmax) for enzymatic assays

  • Visualization approaches:

    • Create structure-function maps showing the spatial distribution of mutation effects

    • Develop heat maps correlating mutation positions with functional parameters

    • Plot evolutionary conservation against functional impact

These approaches enable researchers to distinguish between statistically significant and biologically meaningful effects of mutations .

How can researchers integrate MT-ND4 data with broader mitochondrial genomics to understand energy metabolism adaptations in venomous snakes?

A comprehensive integrative approach should include:

  • Multi-omics integration:

    • Combine MT-ND4 sequence data with whole mitochondrial genome analysis

    • Incorporate transcriptomic data to assess expression levels

    • Add proteomic data to verify post-translational modifications

  • Comparative frameworks:

    • Compare MT-ND4 across venomous and non-venomous snake lineages

    • Examine convergent evolution in species with similar ecological niches

    • Assess coevolution between mitochondrial and nuclear-encoded complex I components

  • Functional correlations:

    • Relate molecular evolution to metabolic rates

    • Investigate potential adaptations to thermal environments

    • Examine possible connections between energy metabolism and venom production

  • Evolutionary analysis:

    • Test for signatures of positive selection in MT-ND4

    • Analyze coevolution between interacting residues

    • Assess the potential role of MT-ND4 in adaptation to different ecological niches

What are the potential applications of recombinant Cerrophidion godmani MT-ND4 in studying mitochondrial disease mechanisms?

Recombinant MT-ND4 from Cerrophidion godmani offers unique opportunities for biomedical research:

  • Comparative disease modeling:

    • Introduce human disease-associated mutations (such as the Arg340His Leber hereditary optic neuropathy mutation) into snake MT-ND4

    • Compare functional consequences between species

    • Identify potential compensatory mechanisms that might exist in snake mitochondria

  • Structural insights:

    • Leverage potential structural differences to understand pathogenic mechanisms

    • Identify regions with differential sensitivity to mutations

    • Explore species-specific interactions with other complex I components

  • Experimental applications:

    • Develop chimeric proteins to map functional domains

    • Use snake MT-ND4 as an alternative template for structure-based drug design

    • Explore potential natural adaptations that might inform therapeutic approaches

  • Translational potential:

    • Identify naturally occurring variants that resist pathogenic mutations

    • Explore mechanisms of mitochondrial efficiency that differ between species

    • Develop novel assay systems using properties unique to snake MT-ND4

The unique evolutionary history of snake mitochondria may provide valuable insights into fundamental mechanisms of mitochondrial function and disease .

How can cryo-EM structural data for MT-ND4 be integrated with molecular dynamics simulations to understand proton pumping mechanisms?

An integrated structural biology approach should include:

  • Cryo-EM data utilization:

    • Generate atomic models from cryo-EM density maps

    • Identify water molecules and ionizable residues in proton translocation pathways

    • Map conformational changes associated with different functional states

  • Simulation setup:

    • Embed the protein complex in a realistic lipid bilayer composition

    • Include bound cofactors and appropriate protonation states

    • Set up systems representing different redox states

  • Simulation analyses:

    • Track proton movement through potential channels

    • Calculate free energy profiles for proton transfer

    • Identify key residues that coordinate water molecules in proton channels

  • Integration with experimental validation:

    • Design mutagenesis experiments based on simulation predictions

    • Correlate simulated energetics with experimental measurements

    • Develop spectroscopic approaches to validate predicted mechanisms

Similar approaches have been successful in understanding Na+-NQR mechanisms and can be adapted for MT-ND4 .

What novel biomarker applications might emerge from studying MT-ND4 variations across Cerrophidion populations?

Exploration of MT-ND4 variation offers potential biomarker applications:

  • Conservation biology applications:

    • Develop MT-ND4-based markers for rapid identification of cryptic Cerrophidion species

    • Create population-specific assays for monitoring genetic diversity

    • Establish non-invasive sampling methods for population surveys

  • Ecological monitoring:

    • Track population movements and gene flow using MT-ND4 haplotypes

    • Assess potential impacts of climate change on population structure

    • Monitor potential hybridization between previously isolated lineages

  • Venom research connections:

    • Investigate potential correlations between MT-ND4 variants and venom composition

    • Explore connections between metabolic efficiency and venom production

    • Develop markers that predict venom properties relevant to antivenom production

  • Evolutionary applications:

    • Use MT-ND4 as a model for studying selection in metabolic genes

    • Investigate potential metabolic adaptations to different prey types

    • Examine coevolution between mitochondrial genes and nuclear-encoded partners

These applications leverage the substantial variation documented in MT-ND4 across Cerrophidion populations to address both basic and applied research questions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.