Recombinant Cervus elaphus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Coat Color Variation

MC1R polymorphisms in deer populations correlate with phenotypic traits:

  • p.L48P Mutation: Observed in fallow deer, this transmembrane substitution reduces cAMP signaling, leading to white coat coloration .

  • Phylogenetic Relevance: Red deer (C. elaphus) MC1R variants are linked to haplogroup B, a mitochondrial lineage distinct in Tyrrhenian and North African populations .

Comparative Analysis with Other Species

SpeciesKey MC1R Feature
C. elaphus (Red deer)High conservation in transmembrane regions; p.L48P variant in fallow deer
Alces alces (Moose)Similar structural domains; recombinant proteins used in evolutionary studies
Homo sapiensPolymorphisms (e.g., R151C) linked to red hair and melanoma risk

Production Challenges and Optimization

Recombinant MC1R production faces hurdles due to:

  • Low Expression Yields: Optimization of codon usage and host systems (e.g., mammalian cells vs. E. coli) is required .

  • Proper Folding: Post-translational modifications (e.g., disulfide bonds in extracellular loops) are critical for activity .

Evolutionary and Ecological Significance

MC1R diversity in C. elaphus populations reflects:

  • Adaptation to UV Exposure: Eumelanin production via MC1R protects against UV-induced DNA damage, critical in high-altitude deer habitats .

  • Human-Driven Population Dynamics: Introductory events (e.g., Tyrrhenian islands) have shaped MC1R haplotypes, as evidenced by haplogroup B’s restricted distribution .

Future Directions

  1. Therapeutic Applications: MC1R modulators for melanoma treatment or depigmentation therapies.

  2. Conservation Genetics: Tracking MC1R diversity in endangered deer subspecies (e.g., C. e. italicus) .

  3. Structural Studies: Cryo-EM or X-ray crystallography to resolve MC1R-α-MSH interactions .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended and aliquoting for long-term storage at -20°C/-80°C is suggested. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Cervus elaphus (Red deer)
Target Names
Target Protein Sequence
MPVLGSQRRLLGSLNCTPPATFPLTLAPNRTGPQCLEVAIPDGLFLSLGLVSLVENVLVV AAIAKNRNLQSPMYYFICCLAMSDLLVSVSNVLETAVMLLLEAGALAARAAVVQQLDNVI DVLICGSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFI TYYNHTVVLLCLVGFFIAMLALMAVLYVHMLARACQHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor 1 (MC1R) acts as a receptor for α-, β-, and γ-melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH). The receptor's activity is mediated by G proteins, which activate adenylate cyclase. MC1R plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MC1R receptor and what are its primary functions in Cervus elaphus?

The Melanocortin-1 Receptor (MC1R) in Cervus elaphus (red deer) is a G-protein coupled receptor that plays critical roles in both pigmentary and non-pigmentary biological functions. Similar to human MC1R, the deer variant regulates melanin synthesis in melanocytes, influencing coat coloration. Beyond pigmentation, MC1R is involved in DNA repair mechanisms, cell cycle regulation, and chromosome stability. Specifically, MC1R activation is linked to DNA damage responses, with evidence showing that functional MC1R is essential for maintaining genomic integrity following ultraviolet radiation exposure. Research has demonstrated that MC1R signaling pathways interact with DNA repair mechanisms like APEX1, which responds to reactive oxygen species (ROS) and oxidative DNA base damage . When studying recombinant Cervus elaphus MC1R, researchers should consider both its pigmentary functions and these crucial cellular maintenance roles.

How do I design primers for amplifying the full-length MC1R gene from Cervus elaphus samples?

When designing primers for full-length Cervus elaphus MC1R amplification, the following methodological approach is recommended:

  • Consult reference sequences from closely related cervid species if direct Cervus elaphus sequence data is unavailable.

  • Target conserved regions flanking the coding sequence (approximately 954 bp for the full coding region).

  • Design primers with the following specifications:

    • 18-25 nucleotides in length

    • GC content between 40-60%

    • Melting temperatures between 55-65°C

    • Minimal secondary structure potential

    • Terminal G or C bases (GC clamp) for stronger binding

For optimal PCR conditions, implement a touchdown protocol starting at 65°C and decreasing to 55°C over 10 cycles, followed by 25 cycles at 55°C. This approach accounts for potential sequence variations between reference data and your specific samples. Post-amplification, sequence verification is essential to confirm successful isolation of the target gene before proceeding with recombinant expression systems.

What expression systems are most suitable for producing recombinant Cervus elaphus MC1R protein?

For producing functional recombinant Cervus elaphus MC1R protein, mammalian expression systems typically yield the most biologically relevant results. Based on research with other MC1R proteins, the following methodological recommendations apply:

  • HEK293 cells: Ideal for maintaining proper post-translational modifications and membrane insertion orientation. Transfection efficiency can be optimized using lipofectamine-based reagents with a typical yield of 2-5 mg/L of culture.

  • Insect cell systems: Sf9 or High Five™ cells with baculovirus vectors provide a balance between mammalian post-translational processing and higher protein yields (typically 5-10 mg/L).

  • Expression vector considerations: Include a purification tag (His6 or FLAG) either N-terminally or C-terminally, with an optional cleavage site. Based on structure studies of similar G-protein coupled receptors, C-terminal tags often interfere less with receptor function .

When evaluating expression systems, consider implementing a small-scale comparative study to determine which system provides the optimal balance between functional activity and yield for your specific experimental requirements.

How do I assess the functional activity of recombinant Cervus elaphus MC1R in vitro?

Assessing recombinant Cervus elaphus MC1R functionality requires a multi-parameter approach focusing on both binding and signaling capabilities:

  • Ligand binding assays:

    • Conduct competitive binding assays using radiolabeled α-MSH or labeled synthetic MC1R agonists.

    • Determine binding kinetics (Kd, Bmax) through saturation binding experiments.

    • Compare binding profiles to positive controls such as human MC1R.

  • Signaling pathway activation:

    • Measure cAMP production following ligand stimulation using ELISA or reporter gene assays.

    • Assess ERK1/2 phosphorylation via Western blotting or ELISA-based methods.

    • Evaluate calcium flux using fluorescent calcium indicators.

  • Functional readouts specific to melanocyte biology:

    • Measure melanin production in transfected melanocytes following receptor activation.

    • Assess expression of downstream genes like MITF using qRT-PCR.

A comprehensive functional characterization should include dose-response curves with EC50 values for various signaling pathways. Additionally, testing receptor response to various agonists and antagonists provides valuable information about receptor pharmacology specific to the Cervus elaphus variant.

What strategies can optimize the purification of recombinant Cervus elaphus MC1R while maintaining its native conformation?

Purifying recombinant MC1R while preserving its native conformation presents significant challenges due to its seven-transmembrane domain structure. Based on successful approaches with other G-protein coupled receptors, the following methodology is recommended:

  • Detergent screening protocol:

    • Test a panel of mild detergents including DDM (n-Dodecyl-β-D-maltoside), LMNG (Lauryl Maltose Neopentyl Glycol), and digitonin.

    • Implement a sequential solubilization approach starting with 0.5-1% detergent concentration.

    • Evaluate each detergent's extraction efficiency via Western blotting.

  • Affinity purification optimization:

    • Utilize immobilized metal affinity chromatography (IMAC) for His-tagged constructs with imidazole gradient elution.

    • Implement size exclusion chromatography as a polishing step to isolate monodisperse receptor populations.

  • Stabilization strategies:

    • Include cholesterol hemisuccinate (CHS) at 0.1-0.2% during purification to stabilize membrane domains.

    • Add specific ligands during purification to stabilize active or inactive conformations.

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) for detergent-free extraction.

The integrity of purified MC1R should be verified through circular dichroism spectroscopy to confirm secondary structure elements, and thermal stability assays to assess conformational stability. Additionally, binding assays with known ligands should be performed pre- and post-purification to verify functional retention.

How do genomic variants of Cervus elaphus MC1R correlate with phenotypic traits, and what methodologies best characterize these relationships?

To characterize MC1R variants in Cervus elaphus and their phenotypic correlations, implement the following comprehensive approach:

  • Variant identification methodology:

    • Sequence the entire MC1R coding region from diverse deer populations.

    • Utilize next-generation sequencing for high-throughput variant discovery across populations.

    • Implement targeted genotyping using custom SNP arrays for large population studies.

  • Phenotypic correlation assessment:

    • Document detailed coat coloration parameters, including standardized color measurements.

    • Record seasonal variation in pelage characteristics.

    • Consider environmental factors that may influence phenotypic expression.

  • Statistical analysis framework:

    • Apply logistic regression models with adjustment for gender and other relevant factors.

    • Calculate odds ratios (OR) with 95% confidence intervals for variant associations.

    • Consider genetic ancestry in analyses using ancestry informative markers (AIMs).

Based on studies in other species, MC1R variants can be classified into functional categories to predict their phenotypic impact:

Variant TypeFunctional ImpactExpected Phenotypic Effect
Wild-type (w)Normal functionStandard species coloration
"r" allelesPartial loss of functionIntermediate color variants
"R" allelesComplete loss of functionMajor color alterations

When conducting genotype-phenotype correlation studies, it's essential to control for population structure using ancestry informative markers and to consider environmental factors that may influence phenotypic expression .

How can recombinant Cervus elaphus MC1R be utilized in evolutionary biology studies?

Recombinant Cervus elaphus MC1R offers valuable opportunities for evolutionary biology investigations through the following methodological approaches:

  • Comparative functional studies:

    • Express MC1R variants from different cervid species in identical cellular backgrounds.

    • Measure signaling responses to identical ligand concentrations across species.

    • Quantify differences in binding affinity, activation thresholds, and downstream pathway engagement.

  • Molecular evolution analysis:

    • Calculate selection pressures (dN/dS ratios) across MC1R sequences from diverse cervid species.

    • Identify positively selected sites that may correlate with habitat adaptation or sexual selection.

    • Reconstruct ancestral MC1R sequences and express them as recombinant proteins to test functional hypotheses.

  • Climate adaptation research:

    • Compare MC1R variants from Cervus elaphus populations across different latitudes.

    • Evaluate whether specific variants correlate with UV radiation exposure levels.

    • Test DNA repair efficiency in cells expressing different MC1R variants following UV irradiation.

When designing evolutionary studies utilizing recombinant MC1R, it's critical to include phylogenetically appropriate outgroups and to account for potential convergent evolution where similar phenotypes may arise from different molecular mechanisms across distinct lineages.

What role might MC1R play in DNA repair mechanisms in Cervus elaphus cells, and how can this be experimentally assessed?

Based on research in human melanocytes, MC1R has demonstrated important functions in DNA repair and chromosome stability that likely extend to Cervus elaphus. To experimentally investigate these functions:

  • DNA damage response assessment:

    • Establish primary fibroblast or melanocyte cultures from Cervus elaphus samples.

    • Transfect cells with wild-type or variant MC1R constructs.

    • Expose cells to UV radiation or other DNA-damaging agents.

    • Quantify DNA damage markers (γH2AX foci, comet assay parameters) at different time points post-exposure.

  • Chromosome stability analysis:

    • Implement Giemsa staining and metaphase spread chromosome analysis in MC1R-manipulated cells.

    • Evaluate centromere integrity through immunofluorescence targeting centromere proteins.

    • Assess micronuclei formation as a marker of chromosomal instability.

  • Molecular pathway investigation:

    • Measure expression of DNA repair genes (APEX1, CDKN2A) following MC1R activation.

    • Evaluate protein-protein interactions between MC1R and DNA repair machinery using co-immunoprecipitation.

    • Assess the requirement for MITF in MC1R-mediated DNA repair through gene silencing experiments.

Research has shown that MC1R silencing augments UV-induced chromosome instability, while MITF overexpression can rescue these effects in human primary melanocytes . Similar experimental designs could determine whether these mechanisms are conserved in Cervus elaphus cells, potentially revealing species-specific adaptations in DNA repair pathways.

How do MC1R expression patterns differ across tissues in Cervus elaphus, and what methodological approaches best characterize this distribution?

To comprehensively characterize MC1R expression patterns across Cervus elaphus tissues:

  • Tissue collection and processing protocol:

    • Collect diverse tissue samples (skin, hair follicles, brain, adrenal glands, immune cells) from ethically sourced specimens.

    • Process tissues using consistent preservation methods (flash freezing for RNA, formalin fixation for histology).

    • Generate tissue microarrays for high-throughput analysis when appropriate.

  • Multidimensional expression analysis:

    • Implement quantitative RT-PCR to measure MC1R transcript levels across tissues.

    • Utilize quantitative immunofluorescence for protein-level detection, with appropriate controls.

    • Perform single-cell RNA sequencing on complex tissues to identify cell-specific expression patterns.

  • Spatial expression characterization:

    • Apply RNAscope in situ hybridization to visualize MC1R transcripts within tissue architecture.

    • Conduct immunohistochemistry with quantitative image analysis for protein localization.

    • Implement multiplexed immunofluorescence to correlate MC1R expression with cell-type markers.

Based on human and other mammalian studies, MC1R expression extends beyond melanocytes to various tissues including brain cells and immune cells . Understanding tissue-specific expression patterns in Cervus elaphus provides critical context for functional studies and may reveal novel roles for MC1R in deer physiology.

What are the best controls to include when studying the functional effects of Cervus elaphus MC1R variants?

When investigating functional effects of Cervus elaphus MC1R variants, implement the following control strategy:

  • Positive and negative expression controls:

    • Include wild-type human MC1R as a well-characterized positive control.

    • Utilize empty vector transfections as negative controls for expression systems.

    • Implement MC1R knockout cell lines when available as baseline controls.

  • Functional parameter controls:

    • Include known functional MC1R variants from human studies (e.g., R151C, R160W, D294H) as reference points.

    • Utilize well-characterized MC1R antagonists (e.g., agouti signaling protein) as pharmacological controls.

    • Apply pathway-specific inhibitors to validate signaling readouts.

  • Expression level normalization:

    • Quantify receptor expression using Western blotting or flow cytometry.

    • Implement ELISA-based surface expression assays to confirm membrane localization.

    • Adjust functional data for expression level differences between variants.

When reporting variant effects, present data normalized to wild-type function and include measures of receptor expression to distinguish between effects on expression versus intrinsic activity. Additionally, sequence-verify all expression constructs before functional testing to confirm the absence of unintended mutations.

How should researchers design experiments to study MC1R-mediated signaling pathways in Cervus elaphus cells?

For rigorous characterization of MC1R-mediated signaling in Cervus elaphus cells:

  • Cell model selection and validation:

    • Establish primary melanocytes or fibroblasts from Cervus elaphus if possible.

    • Alternatively, use heterologous expression in mammalian cell lines with minimal endogenous MC1R expression.

    • Validate models through MC1R expression confirmation via qRT-PCR and Western blotting.

  • Pathway-specific experimental design:

    • cAMP pathway: Implement time-course experiments (5-60 minutes) with dose-response analysis using ELISA or FRET-based sensors.

    • MAPK/ERK pathway: Assess phosphorylation states at multiple time points (5-120 minutes) via Western blotting with phospho-specific antibodies.

    • Calcium signaling: Utilize real-time fluorescent calcium indicators with kinetic readouts.

  • Data analysis framework:

    • Calculate EC50 and Emax values for each pathway activation.

    • Determine temporal activation profiles for multiple pathways.

    • Assess pathway bias by comparing relative activation of different signaling cascades.

Signaling PathwayMeasurement TechniqueTypical TimeframeKey Control
cAMP/PKAELISA, FRET sensors5-60 minForskolin
MAPK/ERKWestern blot, ELISA5-120 minPMA
CalciumFluo-4, Fura-2Seconds-minutesIonomycin
TranscriptionalqRT-PCR, reporter gene1-24 hoursPathway-specific activators

When studying complex signaling networks, consider implementing systems biology approaches such as phosphoproteomics to capture global signaling alterations following MC1R activation.

What techniques allow researchers to assess MC1R protein-protein interactions in Cervus elaphus melanocytes?

To effectively characterize MC1R protein-protein interactions in Cervus elaphus melanocytes:

  • Immunoprecipitation-based methods:

    • Perform co-immunoprecipitation with MC1R-specific antibodies followed by mass spectrometry analysis.

    • Implement proximity-dependent biotin identification (BioID) by fusing biotin ligase to MC1R.

    • Utilize APEX2-based proximity labeling for temporal control of interaction mapping.

  • Live-cell interaction visualization:

    • Apply bimolecular fluorescence complementation (BiFC) for direct interaction visualization.

    • Implement Förster resonance energy transfer (FRET) microscopy for real-time interaction dynamics.

    • Utilize split-luciferase complementation assays for high-sensitivity detection.

  • High-throughput interaction screening:

    • Develop yeast two-hybrid libraries using Cervus elaphus cDNA.

    • Implement mammalian two-hybrid systems for more physiologically relevant screening.

    • Apply protein microarrays for in vitro interaction screening.

When interpreting interaction data, consider the dynamic nature of receptor interactions across different activation states. Compare interaction profiles between basal state receptors and those activated by α-MSH or other agonists. Additionally, interactions should be validated through multiple independent techniques, ideally including at least one method that assesses interactions in living cells.

How might research on Cervus elaphus MC1R inform understanding of adaptation to environmental stressors?

Research on Cervus elaphus MC1R offers valuable insights into environmental adaptation mechanisms through:

  • UV radiation adaptation analysis:

    • Compare MC1R variants from populations across altitudinal gradients with differing UV exposure.

    • Assess DNA repair efficiency in cells expressing different MC1R variants following controlled UV irradiation.

    • Correlate variant distribution with historical UV index data for different habitats.

  • Climate change response investigation:

    • Study temporal changes in MC1R allele frequencies using museum specimens spanning different climate periods.

    • Investigate potential correlations between MC1R variants and thermal tolerance.

    • Assess whether MC1R-mediated stress responses differ across variants under temperature extremes.

  • Experimental methodology:

    • Develop cell culture models expressing different MC1R variants from Cervus elaphus.

    • Expose cells to controlled environmental stressors (UV radiation, temperature fluctuations, oxidative stress).

    • Measure cellular responses including viability, DNA damage repair, and stress pathway activation.

Research has demonstrated that MC1R significantly impacts chromosome stability and centromere integrity in melanocytes, with MC1R silencing increasing susceptibility to UV damage . Similar mechanisms in Cervus elaphus could represent adaptations to specific environmental pressures, potentially revealing molecular pathways important for wildlife conservation in changing environments.

What are the implications of MC1R expression profiles for potential biomarker development in cervid health and disease?

MC1R expression patterns and variants hold potential as biomarkers in cervid health monitoring:

  • Expression level biomarker development:

    • Quantitatively assess MC1R expression across healthy and diseased cervid tissues using techniques like quantitative immunofluorescence.

    • Determine whether MC1R expression changes correlate with specific pathological conditions.

    • Evaluate whether circulating MC1R levels in blood correlate with tissue expression patterns.

  • Variant association methodology:

    • Implement large-scale genotyping of MC1R variants across cervid populations.

    • Correlate specific variants with disease susceptibility or resistance phenotypes.

    • Develop predictive models integrating MC1R genotype with other genetic and environmental factors.

  • Functional biomarker assessment:

    • Measure MC1R signaling pathway activation in accessible tissues (e.g., peripheral blood cells).

    • Determine whether signaling responses correlate with health status or disease progression.

    • Develop standardized functional assays suitable for field application.

Human research has demonstrated that MC1R expression follows a stepwise elevation pattern during melanoma progression, with higher expression in deeper primary lesions and metastatic tumors . Similar expression patterns in cervids might serve as indicators of disease processes, potentially allowing for earlier intervention in valuable wildlife or farmed deer populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.