Recombinant Cervus nippon hortulorum Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

The protein is synthesized using an in vitro E. coli expression system and purified via affinity chromatography . Key quality metrics include:

ParameterSpecification
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% Trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in deionized water; 50% glycerol for long-term stability

Applications in Research

  • Mitochondrial Studies: Used to investigate electron transport chain dynamics in sika deer mitochondria .

  • Species Identification: Serves as a genetic marker for distinguishing Cervus nippon hortulorum from related subspecies like C. n. taiouanus in phylogenetic analyses .

  • Biochemical Assays: Validated for SDS-PAGE and immunoblotting due to high purity and specificity .

Phylogenetic and Conservation Relevance

  • Genetic Differentiation: MT-CYB sequences from C. n. hortulorum show 97–99% identity with other sika deer subspecies, aiding in tracking hybridization events .

  • Conservation Cloning: Used in interspecific somatic cell nuclear transfer (iSCNT) to restore endangered populations, with optimal embryo development achieved in NCSU-23 culture medium .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Cervus nippon hortulorum (Dybowski's sika deer)
Target Names
Target Protein Sequence
IKDILGILLLVLFLMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIP NKLGGVLALVSSILILILMPLLHTSKQRSMMFRPFSQCLFWILVADLLTLTWIGGQPVEY PFIIIGQLASVLYFFIILVLMPITSTIENNLLKW
Uniprot No.

Target Background

Function
A component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Cervus nippon hortulorum Cytochrome b (MT-CYB)?

Recombinant Cervus nippon hortulorum Cytochrome b (MT-CYB) is a laboratory-synthesized protein that replicates the cytochrome b found in the mitochondrial genome of Dybowski's sika deer (Cervus nippon hortulorum). The protein is part of the electron transport chain, functioning as a component of Complex III (ubiquinol-cytochrome-c reductase complex). It serves as a critical element in cellular respiration and energy production in mitochondria. The recombinant form typically maintains the amino acid sequence IKDILGILLLVLFLmLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVSSILILILMPLLHTSKQRSMMFRPFSQCLFWILVADLLTLTWIGGQPVEYPFIIIGQLASVLYFFIILVLMPITSTIENNLLKW and is often tagged for laboratory identification and purification purposes .

How does MT-CYB differ across Cervus nippon subspecies?

Despite taxonomic classifications that separate Cervus nippon into distinct subspecies, phylogenetic analysis of cytochrome b gene sequences reveals that MT-CYB does not cluster according to subspecies designations but rather divides into four distinct lineages. Lineage I includes individuals from C.n.kopschi, C.n.sichuanicus, and C.n.hortulorum; Lineage II consists exclusively of C.n.hortulorum specimens; Lineage III encompasses southern Japanese populations (C.n.centralis, C.n.yakushime, C.n.mageshimae, and C.n.keramae); and Lineage IV represents northern Japanese populations (C.n.centralis and C.n.yesoensis). This genetic organization suggests evolutionary divergence that doesn't align perfectly with morphological classification systems, indicating complex historical biogeographic patterns in sika deer populations .

What is the optimal storage protocol for recombinant MT-CYB samples?

For optimal preservation of recombinant MT-CYB, store the protein at -20°C in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein. For extended storage periods, conservation at -80°C is recommended. To maintain protein integrity, avoid repeated freeze-thaw cycles; instead, prepare working aliquots to be stored at 4°C for periods of up to one week. This protocol maintains structural stability and functional properties of the recombinant protein, ensuring experimental reproducibility and reliability of results in subsequent analyses .

How effective is MT-CYB as a molecular marker for sika deer subspecies identification?

MT-CYB demonstrates variable effectiveness as a molecular marker for sika deer subspecies identification. Research involving 134 sika deer yielded 16 distinct cytochrome b haplotypes, revealing that MT-CYB gene sequences do not cluster according to traditional subspecies classifications. Instead, phylogenetic and haplotype network analyses show four distinct lineages that transcend conventional taxonomic boundaries. While MT-CYB can effectively distinguish between broader populations (such as Chinese versus Japanese sika deer), it cannot reliably differentiate between all formally designated subspecies. This limitation necessitates complementary approaches, such as combining MT-CYB analysis with nuclear microsatellite data, to achieve more accurate subspecies identification and understand the complex genetic relationships within Cervus nippon populations .

What methodological approaches can resolve discrepancies between morphological and molecular classification of sika deer subspecies?

To address discrepancies between morphological and molecular classification of sika deer subspecies, researchers should implement a multi-faceted methodological approach:

  • Integrated genetic analysis: Combine mitochondrial markers (MT-CYB, D-loop) with nuclear microsatellite analysis to provide a more comprehensive genetic picture. Research demonstrates that while mtDNA analysis divided sika deer into four lineages, microsatellite analysis revealed that Chinese and Japanese populations originated independently with different patterns of genetic differentiation .

  • Expanded sampling strategies: Utilize wider geographic sampling to capture the full range of genetic diversity. Studies with broader sample collections have revealed previously undetected genetic relationships .

  • Phylogenomic approach: Employ whole-genome sequencing rather than single gene markers to resolve fine-scale taxonomic relationships.

  • Morphometric analysis correlation: Systematically correlate quantitative morphological traits with genetic markers to identify which physical characteristics reliably align with genetic lineages.

  • BLAST analysis of multiple regions: As demonstrated in research on Korean sika deer cells, BLAST analysis of the mt-DNA D-loop region can provide high-resolution genetic identification, with identity percentages reaching 99-100% for specific subspecies matches .

This integrative approach can better reconcile the observed incongruence between traditional taxonomic classifications and molecular evolutionary relationships.

How can MT-CYB sequence data inform conservation strategies for extinct Cervus nippon hortulorum populations?

MT-CYB sequence data provides critical insights for conservation strategies targeting extinct Cervus nippon hortulorum populations, particularly in regions like the Korean Peninsula where this subspecies is considered endemic but officially extinct. By analyzing MT-CYB sequences, researchers can:

  • Authenticate genetic lineage: Verify the genetic authenticity of potential source populations for reintroduction. Through BLAST analysis of MT-CYB and D-loop regions, researchers have confirmed genetic identity matches of 99% between certain preserved cell lines and reference Cervus nippon hortulorum sequences, validating their suitability for restoration efforts .

  • Guide interspecific somatic cell nuclear transfer (iSCNT): MT-CYB data helps identify suitable donor cells for cloning approaches. Research demonstrates that when cell lines show high genetic similarity (99-99.9%) to Cervus nippon hortulorum mitochondrial genomes, they become prime candidates for nuclear transfer techniques .

  • Avoid genetic contamination: By clarifying the genetic distinctiveness of subspecies, conservation programs can prevent inadvertent hybridization that might compromise the genetic integrity of restoration efforts. Phylogenetic analysis has revealed that sika deer introduced to the Korean Peninsula represent diverse genetic backgrounds, not all of which align with the endemic C.n.hortulorum .

  • Develop appropriate breeding programs: MT-CYB lineage information can inform breeding strategies that maintain evolutionarily significant units rather than morphology-based subspecies designations.

This genetic information ultimately provides the scientific foundation for evidence-based restoration initiatives, potentially using advanced reproductive technologies like iSCNT to resurrect extinct populations while preserving their authentic genetic composition.

What protocol modifications are necessary when using recombinant MT-CYB in ELISA-based detection systems?

When incorporating recombinant Cervus nippon hortulorum MT-CYB in ELISA-based detection systems, several critical protocol modifications are necessary:

  • Buffer optimization: Replace standard ELISA buffers with Tris-based buffer containing 50% glycerol specifically optimized for MT-CYB stability. This modification enhances protein solubility and prevents aggregation during the assay .

  • Storage temperature management: Pre-aliquot the recombinant protein and maintain working solutions at 4°C for no more than one week to preserve epitope integrity. For long-term storage between experiments, maintain stocks at -20°C or -80°C .

  • Antibody selection: Choose antibodies with confirmed cross-reactivity to the specific amino acid sequence of Cervus nippon hortulorum MT-CYB, which may differ slightly from other cervid species at key epitope regions.

  • Blocking optimization: Implement more robust blocking procedures (5-10% BSA rather than standard 1-3%) to minimize background when working with this particular recombinant protein.

  • Extended incubation times: Increase primary antibody incubation periods by 25-50% compared to standard protocols to ensure complete epitope binding.

These modifications help overcome the inherent challenges of working with mitochondrial proteins in immunoassay formats while maximizing specificity and sensitivity of the detection system.

How can researchers optimize culture conditions for iSCNT embryos using Cervus nippon hortulorum donor cells?

Optimizing culture conditions for interspecies somatic cell nuclear transfer (iSCNT) embryos using Cervus nippon hortulorum donor cells requires careful medium selection and protocol refinement. Based on empirical research data:

  • Medium selection: NCSU-23 medium demonstrates superior performance for cultivating iSCNT embryos compared to alternative media like PZM-3 and PZM-5. Experimental data shows that embryos cultured in NCSU-23 achieve higher blastocyst development rates and exhibit better morphological characteristics, including more expanded blastocyst cavities and improved cell homogeneity in the trophectoderm .

  • Developmental stage monitoring: Implement differential assessment protocols for each developmental stage, as culture medium effectiveness varies by embryonic stage. While PZM-5 shows higher cleavage rates from 2-8 cell stages, NCSU-23 outperforms it during morula to blastocyst transition .

  • Morphological evaluation: Employ criteria beyond simple development rates, including blastocyst cavity expansion, inner cell mass (ICM) section blastomere ratios, and trophectoderm cell homogeneity when assessing culture system efficacy .

  • Stage-specific medium transitions: Consider implementing a sequential culture system that transitions embryos from PZM-5 during early cleavage stages to NCSU-23 for later developmental stages to maximize successful development.

This optimization strategy addresses the unique challenges of interspecies nuclear transfer involving Cervus nippon hortulorum genetic material and improves the viability of resulting embryos for conservation or research applications.

How should researchers interpret conflicting phylogenetic signals between MT-CYB and nuclear markers in sika deer taxonomy?

When faced with conflicting phylogenetic signals between MT-CYB and nuclear markers in sika deer taxonomy, researchers should employ the following analytical framework:

  • Recognize inheritance pattern differences: Acknowledge that MT-CYB follows maternal inheritance patterns while nuclear markers represent biparental inheritance. This fundamental difference explains why microsatellite analysis shows significant genetic differentiation among Chinese subspecies while Japanese subspecies exhibit limited differentiation, despite MT-CYB data suggesting different lineage patterns .

  • Consider evolutionary timescales: Evaluate whether discordance reflects different evolutionary histories captured by different genetic markers. MT-CYB mutation rates differ from nuclear markers, potentially capturing different temporal aspects of evolutionary history.

  • Apply analytical reconciliation methods: Implement statistical approaches like Bayesian concordance analysis to quantify support for competing phylogenetic hypotheses across multiple loci.

  • Assess introgression and hybridization: Test whether conflicting signals result from historical introgression events. The fact that sika deer phylogeny based on MT-CYB does not cluster according to subspecies may indicate historical hybridization or incomplete lineage sorting .

  • Integrate biogeographical context: Consider how geographic isolation has influenced population structure. Research demonstrates that sika deer in China and Japan originated independently, explaining some of the observed molecular discrepancies .

Rather than prioritizing one marker system over another, this integrated analytical approach acknowledges the complex evolutionary history of Cervus nippon and produces a more nuanced understanding of taxonomic relationships.

What statistical approaches are most appropriate for analyzing haplotype diversity in MT-CYB sequences across sika deer populations?

For analyzing haplotype diversity in MT-CYB sequences across sika deer populations, researchers should implement a comprehensive statistical framework that includes:

  • Haplotype network analysis: Construct median-joining networks to visualize relationships between haplotypes while preserving ambiguities in the data. This approach has successfully revealed the four major lineages in sika deer that transcend traditional subspecies boundaries .

  • Population genetics parameters: Calculate key metrics including:

    • Haplotype diversity (Hd)

    • Nucleotide diversity (π)

    • Tajima's D and Fu's Fs to test for neutrality and demographic changes

    • Mismatch distribution analysis to detect historical population expansions

  • Phylogeographic analysis: Implement spatial analysis of molecular variance (SAMOVA) to identify groups of populations that are geographically homogeneous and maximally differentiated from each other.

  • Divergence time estimation: Apply Bayesian relaxed clock methods to estimate divergence times between lineages, calibrated with fossil evidence when available.

  • BLAST similarity analysis: For definitively identifying source populations of uncertain samples, use BLAST analysis of MT-CYB sequences against reference databases. Research demonstrates this method's effectiveness in confirming genetic identity with high precision, as shown in the identification of Korean sika deer cell lines with 99-99.9% sequence identity to reference Cervus nippon hortulorum mitochondrial genomes .

This multi-faceted statistical approach provides robust analysis of genetic diversity patterns while accounting for the complex evolutionary history of sika deer populations.

What are the critical factors for successful embryo development in conservation efforts using MT-CYB characterized donor cells?

Successful embryo development in conservation efforts using MT-CYB characterized donor cells depends on several critical factors:

  • Genetic compatibility verification: Prior to employing cells in interspecies somatic cell nuclear transfer (iSCNT), perform comprehensive MT-CYB sequence analysis to confirm taxonomic identity and genetic integrity. Research demonstrates that cell lines with high genetic similarity (99-99.9%) to authentic Cervus nippon hortulorum mitochondrial genomes yield more viable embryos .

  • Culture medium optimization: Select appropriate embryo culture media based on empirical developmental outcomes. Comparative studies show NCSU-23 medium significantly outperforms alternatives for later-stage development, with superior blastocyst formation and expansion rates compared to PZM-3 and PZM-5 media . The developmental outcomes in different media are summarized in the following table:

Medium TypeEarly Cleavage PerformanceMorula to Blastocyst PerformanceBlastocyst Morphology
NCSU-23GoodExcellentWell-expanded cavity with increased ICM ratio
PZM-5ExcellentModerateLess expanded cavity
PZM-3Poor (no development beyond 4-cell)NoneN/A
  • Mitochondrial-nuclear compatibility: Assess compatibility between donor cell nuclear DNA and recipient cytoplasm mitochondrial DNA to minimize potential conflicts in intergenomic communication that can compromise embryo development.

  • Cell cycle synchronization: Implement protocols that effectively synchronize mitotic cycles of nuclear donor cells at G0/G1 stages to enhance nuclear reprogramming efficiency after transfer.

  • Epigenetic reprogramming facilitation: Apply treatments that promote epigenetic reprogramming of donor nuclei, such as histone deacetylase inhibitors, which can improve developmental competence of reconstructed embryos.

These factors collectively address the biological challenges inherent in using characterized donor cells for conservation applications, ultimately improving the viability of embryos created through advanced reproductive technologies.

How can researchers integrate MT-CYB data with emerging genomic technologies for comprehensive cervid conservation strategies?

Researchers can integrate MT-CYB data with emerging genomic technologies to develop comprehensive cervid conservation strategies through the following approaches:

  • Whole-genome resequencing integration: Combine MT-CYB haplotype information with whole-genome resequencing data to develop high-resolution conservation units that better reflect evolutionary history. While MT-CYB analysis has identified four major lineages in sika deer, whole-genome data can reveal fine-scale population structure for more precise conservation planning .

  • CRISPR-Cas9 applications: Use MT-CYB sequence variations as guides for potential CRISPR-Cas9 applications in genetic rescue operations. Precise genetic characterization facilitates targeted genetic interventions that might be necessary for small, isolated populations with compromised genetic diversity.

  • Environmental DNA (eDNA) monitoring: Develop MT-CYB-based eDNA assays to monitor wild populations non-invasively. The specificity of MT-CYB sequences enables development of primers that can detect Cervus nippon hortulorum DNA from environmental samples.

  • Single-cell genomics for embryo selection: Implement single-cell genomics approaches to evaluate iSCNT-derived embryos prior to implantation. By assessing both nuclear and mitochondrial genomic integrity in individual blastomeres, researchers can select embryos with optimal developmental potential for conservation breeding programs .

  • Comparative cultural genomics: Establish databases that integrate MT-CYB data with optimized culture conditions for specific genetic lineages. Research demonstrates that different media (NCSU-23, PZM-5, PZM-3) produce dramatically different developmental outcomes, suggesting genomic-environmental interactions that must be considered in conservation applications .

This integrated approach leverages traditional MT-CYB phylogenetics with cutting-edge genomic technologies to create more effective and genetically informed conservation strategies for threatened cervid populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.