Recombinant Cervus nippon pseudaxis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cervus nippon pseudaxis Cytochrome b (MT-CYB)

Recombinant Cervus nippon pseudaxis Cytochrome b (MT-CYB) is a recombinant protein derived from the Tonkin sika deer, a subspecies of the sika deer (Cervus nippon). This protein is a crucial component of the mitochondrial electron transport chain, specifically part of Complex III, also known as the ubiquinol-cytochrome c reductase complex. The cytochrome b subunit plays a pivotal role in energy production and is essential for cellular respiration.

Structure and Function

Cytochrome b is a hydrophobic protein consisting of eight transmembrane helices. It contains two hemes and forms the ubiquinol and inhibitor binding sites, known as Qo and Qi sites, which are critical for the electron transport process . This protein is encoded by mitochondrial DNA (mtDNA) and is involved in generating a proton gradient across the mitochondrial inner membrane, which drives ATP synthesis.

Recombinant Production

The recombinant Cervus nippon pseudaxis Cytochrome b (MT-CYB) is produced in mammalian cells, ensuring high purity (>85% as determined by SDS-PAGE) and biological activity . The protein is available in both liquid and lyophilized forms, with shelf lives of 6 months and 12 months, respectively, when stored at -20°C/-80°C .

References Phylogeography of sika deer (Cervus nippon) inferred from mitochondrial sequences and nuclear microsatellites. Population genetic structure of the malaria vector Anopheles minimus in Thailand. Human Mitochondrial Cytochrome b Variants Studied in Yeast. Genome-Wide SNP Discovery and Analysis of Genetic Diversity in Sika Deer. Recombinant Cervus nippon pseudaxis Cytochrome b (MT-CYB) product information.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Cervus nippon pseudaxis (Tonkin sika deer)
Target Names
Target Protein Sequence
IKDILGILLLMLFLMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIP NKLGGVLALVSSILILILMPFLHTSKQRSMMFRPFSQCLFWILVADLLTLTWIGGQPVEY PFIIIGQLASVLYFFIILVLMPITSTIENNLLKW
Uniprot No.

Target Background

Function
Recombinant *Cervus nippon pseudaxis* Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane, which is crucial for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.