Recombinant Cervus nippon taiouanus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Cervus nippon taiouanus (Formosan sika deer)
Target Names
Target Protein Sequence
KDILGILLLMLFLMLLVLFAPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAILRSIPN KLGGVLALVSSILILILMPFLHTSKQRSMMFRPFSQCLFWILVADLLTLTWIGGQPVEYP FIIIGQLASILYFFIILVLMPITSTIENNLLKW
Uniprot No.

Target Background

Function
Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic significance of Cytochrome b in Cervus nippon taiouanus?

Cytochrome b (MT-CYB) serves as a crucial mitochondrial marker for taxonomic identification and phylogenetic analysis of Cervus nippon taiouanus, a subspecies native to Taiwan. This gene has been extensively used to determine the evolutionary relationships among various sika deer subspecies. Genetic studies utilizing MT-CYB sequences have confirmed that C. n. taiouanus represents a distinct genetic lineage within the sika deer complex. Analyses reveal that C. n. taiouanus forms a separate clade from other subspecies such as C. n. yakushimae (native to Japan), with molecular evidence showing unique haplotype patterns that correspond to its geographic origin . The genetic sequences of C. n. taiouanus MT-CYB have been documented in multiple databases with accession numbers such as EF058308.1 and AB279722.1, facilitating comparative genomic studies across different populations .

How do researchers distinguish Cervus nippon taiouanus from other sika deer subspecies using MT-CYB?

Researchers employ several methodological approaches to distinguish C. n. taiouanus from other subspecies using MT-CYB sequences. The process typically begins with DNA extraction from tissue samples (often from roadkill or archived specimens), followed by PCR amplification of the MT-CYB region. Sequencing of the amplified products reveals distinct haplotype patterns that can be analyzed through phylogenetic methods. The genetic distance between C. n. taiouanus and other subspecies, particularly C. n. yakushimae, has been calculated at approximately 1.81 million years divergence time, indicating significant evolutionary separation .

Specific nucleotide polymorphisms within the MT-CYB gene serve as diagnostic markers for subspecies identification. Researchers employ maximum likelihood tree construction based on the Tamura-Nei model, which produces robust phylogenetic trees that distinctly cluster C. n. taiouanus in a separate clade from other subspecies. BLAST analysis comparing unknown samples against reference sequences can achieve identification with 99% identity to known C. n. taiouanus sequences .

What evolutionary insights have been gained from studying C. n. taiouanus MT-CYB sequences?

Studies of C. n. taiouanus MT-CYB have revealed important evolutionary insights, including temporal divergence patterns and biogeographical distribution. The estimated divergence time of 1.81 million years between C. n. taiouanus and C. n. yakushimae indicates ancient separation of these lineages, potentially corresponding to major geological or climatic events that isolated populations .

More recent divergence patterns within the C. n. taiouanus lineage itself (less than 0.17 million years) suggest more recent population dynamics. These molecular clock estimates help researchers understand how island isolation and geographical barriers have shaped the evolution of these subspecies. The sympatric distribution of different sika deer lineages in certain regions, such as Jeju Island in South Korea, provides evidence of human-mediated introductions and potential hybridization events that complicate conservation efforts .

What expression systems are most effective for producing recombinant Cervus nippon taiouanus MT-CYB?

Based on related research with mitochondrial proteins, the optimal expression systems for recombinant C. n. taiouanus MT-CYB production include bacterial (E. coli), yeast (P. pastoris), and mammalian cell systems (HEK293, CHO), each with distinct advantages. For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems are preferred despite their higher cost and complexity. The porcine cell lines used in interspecies somatic cell nuclear transfer (iSCNT) experiments suggest compatibility with porcine expression systems for deer mitochondrial proteins .

When using bacterial expression systems, codon optimization based on the specific nucleotide preferences of C. n. taiouanus MT-CYB is crucial. Researchers should incorporate affinity tags (His6, GST, or MBP) to facilitate purification, while ensuring these additions don't interfere with protein folding or function. Expression conditions, including temperature (typically lowered to 18-25°C), IPTG concentration (0.1-0.5 mM), and induction duration (4-16 hours), must be carefully optimized to maximize soluble protein yield.

What analytical techniques are essential for characterizing recombinant MT-CYB structure and function?

Comprehensive characterization of recombinant MT-CYB requires multiple analytical approaches. Structural characterization typically begins with SDS-PAGE and Western blotting to confirm protein size and immunoreactivity. Circular dichroism (CD) spectroscopy provides insights into secondary structure content, while thermal shift assays assess protein stability. For higher-resolution structural information, X-ray crystallography or cryo-electron microscopy may be employed, though membrane proteins like MT-CYB present significant crystallization challenges.

Functional characterization focuses on electron transport activity, typically measured through spectrophotometric assays tracking cytochrome c reduction. Oxygen consumption measurements using electrode-based systems provide complementary data on electron transport chain functionality. Binding studies with inhibitors like antimycin and myxothiazol can identify species-specific differences in inhibitor sensitivity, potentially revealing structural differences between C. n. taiouanus MT-CYB and other subspecies.

How can researchers optimize purification protocols for recombinant C. n. taiouanus MT-CYB?

Purification of recombinant MT-CYB presents significant challenges due to its hydrophobic nature as a membrane protein. A multi-step purification strategy typically begins with cell lysis using detergents (DDM, LDAO, or Triton X-100) to solubilize membrane proteins. Affinity chromatography utilizing engineered tags (His6, FLAG, or Strep) provides initial purification, followed by size exclusion chromatography to remove aggregates and achieve higher purity.

For functional studies, researchers should carefully select detergents that maintain native protein conformation and activity. Amphipols or nanodiscs can be employed for detergent exchange during later purification stages, enhancing protein stability. Quality control assessments should include purity verification by SDS-PAGE (aiming for >95% purity), activity assays to confirm functional integrity, and dynamic light scattering to evaluate sample homogeneity and detect aggregation.

How is MT-CYB used to understand phylogenetic relationships among Cervus species?

MT-CYB sequences provide valuable data for resolving phylogenetic relationships among Cervus species and subspecies. Researchers employ multiple sequence alignment tools (MUSCLE, ClustalW) to compare MT-CYB sequences, followed by phylogenetic tree construction using maximum likelihood methods. These analyses have revealed distinct clustering patterns, with C. n. taiouanus forming a separate clade from other subspecies such as C. n. yakushimae .

The phylogenetic trees constructed from MT-CYB data help resolve taxonomic uncertainties and clarify evolutionary relationships. For example, research has shown that C. n. taiouanus clusters with sequences reported from Taiwan (DQ985076), the United Kingdom (L15083), and South Korea (GU377259), suggesting potential historical introductions or shared ancestry . To enhance phylogenetic resolution, researchers often combine MT-CYB data with other genetic markers, including additional mitochondrial genes (COI, D-loop) and nuclear loci, providing a more comprehensive evolutionary picture.

What data analysis approaches resolve inconsistencies between morphological and molecular classifications of Cervus subspecies?

Resolving inconsistencies between morphological and molecular classifications of Cervus subspecies requires integrated analytical approaches. Some studies have shown differences in phylogenetic information between morphological and mitochondrial DNA marker classification methods, necessitating reconciliation between these data types .

Researchers employ statistical methods like STRUCTURE analysis to detect population structure and admixture, which is particularly important in regions where multiple subspecies coexist, such as Jeju Island. Bayesian phylogenetic approaches implement models that can accommodate both morphological and molecular data simultaneously, providing a unified framework for subspecies delineation. Landmark-based morphometrics combined with molecular data in discriminant function analysis can identify correlations between physical traits and genetic lineages, potentially revealing instances of convergent evolution or retained ancestral traits that may confound traditional taxonomic assignments.

How does MT-CYB analysis contribute to conservation genetics of endangered Cervus subspecies?

MT-CYB analysis plays a crucial role in conservation genetics by identifying genetically distinct populations requiring preservation. For endangered Cervus subspecies, including some populations of C. n. taiouanus, MT-CYB sequencing helps establish conservation units based on evolutionary significance. This genetic information guides breeding programs and reintroduction efforts, ensuring genetic diversity is maintained.

Molecular monitoring using MT-CYB markers can detect illegal trafficking and poaching by tracing the origin of sika deer products, supporting law enforcement efforts. In areas where introduced sika deer subspecies have become invasive, such as mainland South Korea and Jeju Island, MT-CYB analysis helps identify non-native genetic lineages that may threaten native ecosystems . Conservation strategies informed by genetic data include selective removal of non-native genotypes, habitat management to minimize hybridization, and establishment of genetic repositories for future restoration efforts.

How is MT-CYB analysis integrated into interspecific somatic cell nuclear transfer (iSCNT) for species restoration?

MT-CYB analysis provides critical genetic information for interspecific somatic cell nuclear transfer (iSCNT) programs aimed at restoring extinct or endangered deer populations. Researchers use MT-CYB sequences to verify the taxonomic identity of donor cells before nuclear transfer, ensuring they represent the target subspecies. This genetic verification is essential when working with historic samples or specimens from diverse geographic origins, as demonstrated in studies attempting to restore extinct sika deer populations in Korea .

In iSCNT protocols, mitochondrial compatibility between donor cells and recipient oocytes significantly impacts developmental success. MT-CYB analysis helps assess mitochondrial DNA consistency, which is crucial for successful nuclear-mitochondrial interactions in the resulting embryos. Research has shown that porcine oocytes provide a suitable cytoplasmic environment for deer nuclear transfer, with high rates of blastocyst formation and hatching efficiency compared to other interspecies combinations . The cultural system optimization in NCSU-23 medium has demonstrated superior results for deer-pig hybrid embryos, with 7.9% developing to the blastocyst stage compared to poorer outcomes in other media formulations .

What challenges exist in using MT-CYB data for reliable subspecies identification in restoration projects?

Several challenges complicate the use of MT-CYB data for reliable subspecies identification in restoration projects. Incomplete lineage sorting and historical hybridization events can create conflicting phylogenetic signals, making species boundaries appear blurred. Additionally, nuclear mitochondrial DNA segments (NUMTs) - nuclear copies of mitochondrial genes - can contaminate analyses if not properly identified and filtered out.

The sympatric distribution of multiple deer subspecies in certain regions, such as the documented presence of both C. n. yakushimae and C. n. taiouanus on Jeju Island, creates difficulties in identifying pure ancestral lineages for restoration . Researchers must employ multiple genetic markers beyond MT-CYB, including nuclear loci and complete mitochondrial genomes, to achieve accurate subspecies identification. Advanced bioinformatic approaches, such as coalescent-based species delimitation methods, help distinguish between incomplete lineage sorting and hybridization scenarios, providing more reliable taxonomic boundaries for conservation programs.

What methodological approaches resolve challenges in amplifying and sequencing MT-CYB from degraded samples?

Working with degraded samples from museum specimens, archaeological remains, or environmental DNA presents significant challenges for MT-CYB analysis. Researchers implement specialized DNA extraction protocols optimized for low-quality samples, often incorporating silica-based purification methods with modified binding and elution conditions. PCR amplification strategies for degraded DNA typically target shorter overlapping fragments of the MT-CYB gene (100-200 bp) rather than attempting to amplify the entire gene in one reaction.

To overcome PCR inhibition common in degraded samples, researchers employ additives such as BSA, DMSO, or betaine in reaction mixtures. Multiple displacement amplification (MDA) or other whole-genome amplification approaches may be utilized prior to targeted PCR when starting DNA quantities are extremely limited. For sequencing challenges, researchers increasingly turn to next-generation sequencing platforms that can accommodate short fragments and provide high coverage depth, compensating for sequence errors in degraded samples. Bioinformatic pipelines specifically designed for ancient DNA analysis help filter authentic sequences from contamination and damage-induced artifacts.

How do researchers address nuclear mitochondrial DNA segments (NUMTs) when analyzing MT-CYB?

Nuclear mitochondrial DNA segments (NUMTs) represent a significant challenge in MT-CYB analysis, as these nuclear pseudogenes can be inadvertently amplified alongside authentic mitochondrial sequences. To address this challenge, researchers employ mitochondrial enrichment procedures before DNA extraction, including differential centrifugation to isolate intact mitochondria or commercial kits designed for mitochondrial DNA purification.

PCR primer design strategies target sequences flanking MT-CYB that are absent in known NUMTs, increasing the specificity for authentic mitochondrial amplicons. Long-range PCR approaches can help avoid NUMT amplification, as nuclear insertions are typically fragmented and shorter than complete mitochondrial genes. During sequence analysis, researchers carefully examine electropherograms for signs of mixed bases indicating co-amplification of NUMTs with authentic MT-CYB. Phylogenetic screening identifies potential NUMTs by their aberrant placement in trees or unusually long branch lengths. When NUMTs cannot be avoided during amplification, cloning of PCR products followed by screening multiple clones helps separate authentic mitochondrial sequences from nuclear copies.

What experimental design considerations are essential when using MT-CYB for hybridization detection between Cervus subspecies?

Experimental design for detecting hybridization between Cervus subspecies using MT-CYB requires careful consideration of several factors. Researchers must recognize that MT-CYB, as a maternally inherited marker, can only detect hybridization events through the maternal lineage. To comprehensively assess hybridization, complementary nuclear markers, including microsatellites, SNPs, or nuclear gene sequences, should be analyzed alongside MT-CYB.

Sampling strategy significantly impacts hybridization detection, with comprehensive geographic sampling across potential hybrid zones being essential. On Jeju Island, where both C. n. yakushimae and C. n. taiouanus have been introduced and now exist sympatrically, researchers collected samples from multiple locations to assess potential hybrid zones . Statistical approaches for hybridization analysis include Bayesian assignment methods, which calculate the probability of individual assignment to parental populations or hybrid categories. Simulation studies help determine the minimum number of genetic markers needed to detect various hybridization scenarios with desired statistical power. When complex hybridization patterns are suspected, genomic approaches such as reduced representation sequencing or whole-genome sequencing provide higher resolution than single-marker analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.