Recombinant Chaetodipus baileyi Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Chaetodipus baileyi (Bailey's pocket mouse) (Perognathus baileyi)
Target Names
Target Protein Sequence
MPMQEPQRRLLDPFNSTRTGTPHLKLSANQTGPWCLHVSIPDGLFLSLGLVSLVENVLVV ISIAKNRNLHSPMYYFICCLALSDLLVSVSIVLETTLILVLEAGALATRVTVVQQLDNVI DVLICGSMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARWAIVAIWVASISSSTLFV AYYNHTAVLLCLVTFFLATLALMAVLYVHMLARAHQHAQAIAQLHKRQHLVHQGFRLKGA ATLTILLGIFFLCWGPFFLYLTLIVLCPKHPTCSCFFKNLNLFLALIIFNSIVDPLIYAF RSQELRMTLKEVLLCSW
Uniprot No.

Target Background

Function

The melanocyte-stimulating hormone receptor (MC1R) is a G protein-coupled receptor for α-, β-, and γ-MSH and ACTH. Its activation stimulates adenylate cyclase, mediating melanogenesis – the production of eumelanin (black/brown) and phaeomelanin (red/yellow) pigments – through cAMP signaling regulation in melanocytes.

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of MC1R in Chaetodipus species?

The MC1R gene has been identified as a key molecular target underlying adaptive pigmentation in rodents, particularly pocket mice of the Chaetodipus genus. In natural populations of rock pocket mice (C. intermedius), MC1R mutations are associated with adaptive melanism on dark lava substrates, providing concealing coloration against predators . This represents a clear example of natural selection driving phenotypic adaptation through specific molecular changes. While C. baileyi has been less studied than C. intermedius, the evolutionary patterns observed in related species suggest MC1R likely plays a similar role in adaptive coloration across the genus, making it an excellent model for studying the genetic basis of adaptation.

How does the structure of MC1R relate to its function in pigmentation?

MC1R is a G-protein coupled receptor with seven transmembrane (TM) domains, four extracellular domains (ED), and four intracellular domains (ID) . These different structural components experience varying selective pressures, with some regions showing accelerated rates of evolution. When activated by α-melanocyte-stimulating hormone, MC1R triggers a signaling cascade that promotes eumelanin (dark pigment) production over pheomelanin (light/yellow pigment). Mutations that constitutively activate the receptor lead to dominant dark phenotypes, while loss-of-function mutations typically result in recessive light phenotypes . The critical functional regions include the first intracellular and first extracellular domains, where mutations in mice have been shown to cause hyperactive or constitutively active receptors .

What patterns of selection have been observed in rodent MC1R evolution?

Analysis of MC1R across rodent lineages reveals a complex pattern of selective pressures. While purifying selection has dominated MC1R evolution in many mammalian groups (cetartiodactyls, mustelids, and primates), rodents show evidence of both purifying selection and localized positive selection . Molecular evolution analyses have identified specific sites under positive selection, particularly at positions 26 (in the extracellular domain) and 251 (in the transmembrane domain) . Additionally, many sites show relaxed functional constraints (ω values around 0.38), suggesting greater evolutionary flexibility in certain regions of the receptor . This mixed pattern of selection likely reflects the adaptive importance of pigmentation in predator avoidance across diverse rodent habitats.

How do different mutations in MC1R contribute to phenotypic variation in pigmentation?

The relationship between MC1R mutations and phenotypic outcomes is complex and context-dependent. In C. intermedius, four specific mutations in MC1R are perfectly associated with dark coat color in one population (Pinacate), but notably, a different melanic population showed no association with MC1R mutations . This suggests that adaptive dark coloration has evolved independently through changes in different genes. Researchers investigating C. baileyi should consider potential parallel genetic pathways, including interactions with genes like agouti, which also influences banding patterns in rodent hair . When characterizing novel MC1R variants, researchers should evaluate: (1) constitutive activity levels, (2) ligand responsiveness, (3) G-protein coupling efficiency, and (4) cell-surface expression patterns, as these factors collectively determine phenotypic outcomes.

What methodological approaches are most effective for studying recombinant MC1R function?

Functional characterization of recombinant MC1R requires a multi-faceted approach. Begin with heterologous expression systems (typically HEK293 cells) transfected with the MC1R construct. Measure cAMP production using sensitive reporter assays to assess basal activity and response to α-melanocyte-stimulating hormone at varying concentrations (10^-12 to 10^-6 M). Membrane localization should be confirmed via immunocytochemistry with fluorescently tagged receptors. Mutational analysis using site-directed mutagenesis of conserved residues can identify critical functional domains. For C. baileyi specifically, comparative analysis with well-characterized MC1R variants from C. intermedius provides valuable reference points. Finally, co-expression with interacting proteins, particularly MRAP (melanocortin receptor accessory protein), is essential as it modulates receptor trafficking and function in vivo.

How can population genetics approaches enhance our understanding of MC1R variation in natural populations?

Population genetics offers powerful tools for understanding the evolutionary dynamics of MC1R in natural populations. Researchers should sample C. baileyi across environmental gradients, particularly across boundaries of different substrate colors, where selection for crypsis may drive coat color adaptation. Mitochondrial DNA analysis can help identify population structure and verify that phenotypic divergence exceeds neutral genetic differentiation, a signature of selection . Calculate FST values for phenotypic traits and neutral markers to estimate selection strength, as demonstrated in C. intermedius where FST(Phenotype) = 0.62 greatly exceeded FST(mtDNA) = 0.01 . Additionally, scan for selective sweeps around the MC1R locus using high-density SNP markers. Lastly, environmental correlation analyses can link specific MC1R variants to ecological variables, strengthening inference about adaptive significance.

What expression systems are optimal for producing functional recombinant C. baileyi MC1R?

For optimal expression of recombinant C. baileyi MC1R, several expression systems should be considered:

  • Mammalian cell lines: HEK293 cells provide the most physiologically relevant environment for functional MC1R studies, as they contain the necessary G-protein coupling machinery. Use a strong promoter (CMV) and codon-optimized sequence for maximum expression.

  • Insect cell expression: Sf9 cells with baculovirus expression systems offer high yield for structural studies but may have different post-translational modifications.

  • Yeast expression systems: Pichia pastoris provides an alternative for large-scale production but requires optimization of growth conditions.

The expression construct should include a cleavable purification tag (His6 or FLAG) and fluorescent reporter (GFP) for tracking expression and localization. Additionally, co-expression with MRAP2 (melanocortin receptor accessory protein 2) may enhance functional expression, as this has been demonstrated to improve trafficking of MCRs to the cell surface in heterologous systems .

How should researchers analyze domain-specific evolutionary patterns in MC1R?

To analyze domain-specific evolutionary patterns in MC1R, researchers should employ the following methodology:

  • Sequence MC1R from multiple C. baileyi populations and related species.

  • Align sequences and partition into functional domains (EDs, TMs, IDs) based on structural predictions.

  • Calculate domain-specific rates of nonsynonymous (dN) and synonymous (dS) substitutions using the Nei and Gojobori method as implemented in PAML .

  • Apply site-specific selection models (M0-M8) to identify potential residues under positive selection.

  • Use branch-site models to test for lineage-specific selection patterns.

This approach has revealed domain-specific evolutionary rates in rodent MC1R, with some segments showing accelerated evolution in specific lineages (see Table 1 below) .

Table 1. Domain-specific dN/dS Ratios Across Rodent Lineages

DomainMouse-related cladeSquirrel-related cladeCtenohystrica
ED10.320.290.45
ED40.410.220.25
ID10.380.210.27
ID20.300.280.43
TM10.350.190.24
TM40.390.200.25

What are the best approaches for linking MC1R genotype to pigmentation phenotype in C. baileyi?

Establishing causal relationships between MC1R variants and pigmentation phenotypes requires multiple lines of evidence:

  • Association studies: Sample C. baileyi populations with varying coat colors and sequence the MC1R coding region to identify variants that correlate with phenotype .

  • Functional assays: Express identified variants in cell culture to measure:

    • Basal activity (constitutive signaling)

    • Ligand responsiveness (EC50 and maximum response)

    • Cell surface expression levels

  • Transgenic approaches: While challenging in non-model organisms, CRISPR-Cas9 gene editing in closely related model rodents can verify phenotypic effects of specific mutations.

  • Histological analysis: Characterize melanin content and distribution in hair follicles from different phenotypes using Fontana-Masson staining to distinguish eumelanin from pheomelanin.

  • Hair morphology analysis: Document banding patterns and pigment distribution along individual hairs, as unbanded, uniformly melanic hairs characterize dark phenotypes in pocket mice .

This multi-faceted approach is necessary because, as demonstrated in C. intermedius, similar dark phenotypes can arise through different genetic mechanisms, even within the same species .

How can researchers identify non-MC1R genes involved in pigmentation adaptation in C. baileyi?

As demonstrated in some populations of C. intermedius, adaptive melanism can evolve independently of MC1R mutations . To identify alternative genetic pathways:

  • Candidate gene approach: Sequence known pigmentation genes including:

    • Agouti signaling protein (ASIP) - antagonist of MC1R

    • Attractin (ATRN) - involved in ASIP signaling

    • Mahogunin (MGRN1) - E3 ubiquitin ligase affecting pigmentation

    • Tyrosinase (TYR) and related proteins (TYRP1, DCT) - melanogenic enzymes

  • QTL mapping: In populations where MC1R does not explain phenotypic variation, perform QTL analysis using dense marker sets.

  • RNA-seq: Compare gene expression in developing hair follicles between light and dark phenotyped animals to identify differentially expressed genes.

  • Genome-wide association: Perform whole-genome sequencing on phenotypic extremes to identify associated variants.

  • Selection scans: Identify genomic regions showing signatures of selection (reduced heterozygosity, extended haplotype homozygosity) that may harbor pigmentation genes.

This comprehensive approach recognizes that convergent phenotypic evolution may occur through diverse genetic mechanisms, requiring broader investigation beyond a single candidate gene.

How might climate change affect selection on MC1R variants in C. baileyi populations?

Climate change poses significant challenges for species with substrate-matched coloration. As researchers investigate this question:

  • Establish baseline frequencies of MC1R variants across environmental gradients in current C. baileyi populations.

  • Model potential habitat shifts under climate change scenarios, particularly focusing on changes in substrate coloration or vegetation cover that might alter predation pressure.

  • Develop experimental approaches to test selection strength under different environmental conditions, potentially using enclosure experiments with varying predator exposure.

  • Consider phenotypic plasticity in pigmentation as a potential buffer against rapid environmental change.

Selection on crypsis is likely mediated by visually oriented predators, and maintenance of appropriate coloration will be under strong ecological pressure as environments change . Researchers should establish long-term monitoring programs to track allele frequency changes in relation to environmental variables over time.

What can comparative genomics reveal about convergent evolution of pigmentation across rodent species?

Comparative genomics approaches offer powerful insights into convergent evolution:

  • Sequence MC1R and other pigmentation genes from multiple species showing similar adaptive coloration patterns (e.g., comparing C. baileyi with Peromyscus species that also show substrate matching).

  • Identify cases of parallel molecular evolution (same genes, same mutations) versus convergent phenotypic evolution through different genetic mechanisms.

  • Analyze regulatory regions of pigmentation genes to identify shared or distinct regulatory mechanisms driving similar phenotypes.

  • Apply phylogenetic comparative methods to test for correlated evolution between environmental variables and pigmentation phenotypes across the rodent phylogeny.

This approach can reveal whether certain genes or pathways are predictable "hotspots" for evolutionary change in pigmentation, or if adaptation routinely proceeds through diverse genetic mechanisms, as suggested by the distinct genetic basis of melanism in different C. intermedius populations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.