Recombinant Chaetodipus penicillatus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please communicate your request in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Chaetodipus penicillatus (Desert pocket mouse) (Perognathus penicillatus)
Target Names
Target Protein Sequence
MPMQEPQRRLLGPFNSTRTGAPHLELSANQTGPWCLHVSIPDGLFLSLGLVSLVENVLVV ISIAKNQNLHSPMYYFICCLALSDLLVSVSIVLETTLILVLEAGALATRVTVVQQLDNVI DVLICASMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARWAIVAIWVASISSSTLFV AYYNHTAVLLCLVTFFLATLALMVVLYVHMLARAHQHAQAIAQLHKRQHLVHQGFRLKGA ATLTILLGIFFLCWGPFFLYLTLIVLCPKHPTCGCFFKNLNLFLALIIFNSIVDPLIYAF RSQELRMTLKEVLLCSW
Uniprot No.

Target Background

Function
This receptor binds to melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) and adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins that activate adenylate cyclase. It plays a key role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MC1R and what is its primary function in Chaetodipus species?

MC1R (Melanocyte-stimulating hormone receptor) is a seven-transmembrane G protein-coupled receptor that plays a critical role in pigmentation pathways in mammals, including pocket mice species like Chaetodipus. The receptor is encoded by the MC1R gene and functions as a receptor for melanocortin peptides, including melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH) . In pocket mice, as in other mammals, MC1R activation triggers signaling cascades that influence the eumelanin-to-phaeomelanin ratio, directly impacting coat color phenotypes . The activity of this receptor is mediated by G proteins that activate adenylate cyclase, increasing cAMP production and ultimately affecting melanin synthesis . In Chaetodipus species, mutations in this gene have been associated with adaptive melanism, particularly in populations living on dark substrates like lava flows .

How does the structure of MC1R in Chaetodipus compare to other rodent species?

While specific structural data for Chaetodipus penicillatus MC1R has not been fully characterized, research on related rodent species provides insight into the likely structural conservation. The MC1R protein typically consists of 317 amino acids forming a single-exon gene encoding a seven-transmembrane domain structure characteristic of G protein-coupled receptors . Molecular evolution studies across rodents reveal abundant amino acid variation throughout the MC1R gene, with variability distributed across extracellular domains (EDs), transmembrane domains (TMs), and intracellular domains (IDs) .

Research on the rock pocket mouse (Chaetodipus intermedius) has identified specific amino acid polymorphisms associated with coat color adaptation, including positions 18, 109, 160, and 233 . These functional sites are likely conserved across Chaetodipus species. When designing experiments with recombinant C. penicillatus MC1R, researchers should consider analyzing these key residues, as they may exhibit similar functional significance. Comparative sequence analysis between C. penicillatus and other well-studied rodent MC1Rs can provide further insights into structural conservation and divergence.

What are the most effective methods for cloning and expressing MC1R from Chaetodipus tissue samples?

Effective cloning of MC1R from Chaetodipus tissues requires optimization of several methodological steps:

  • RNA Extraction and cDNA Synthesis: Total RNA should be isolated from tissue samples (preferably skin or hair follicles) using Trizol reagent following manufacturer protocols. Pooling RNA from multiple individuals (4-5) can provide sufficient starting material and account for individual variation . First-strand cDNA synthesis should be performed using reverse transcriptase with oligo-dT or random primers.

  • PCR Amplification Strategy: A degenerate primer approach is recommended for initial cloning, particularly if the exact sequence is unknown. Design primers targeting conserved amino acid regions based on alignment of MC1R sequences from closely related species. For example, in studies with C. intermedius, primers were designed against conserved amino acid motifs such as GLISLVENI and IICNSLIDPL . Gradient PCR programs (e.g., 95°C for 2:00; 95°C for 0:30; 48°C–58°C for 0:30; 72°C for 1:30; for 35 cycles) have proven effective for amplifying MC1R from rodent templates.

  • Cloning and Sequence Verification: PCR products should be subcloned into appropriate vectors (e.g., pGEM-Teasy vector) and sequenced to confirm identity using BLAST comparison . For expression studies, the verified sequence should be subcloned into mammalian expression vectors with appropriate tags for detection and purification.

  • Expression Systems: For recombinant protein production, multiple expression systems should be considered, similar to those used for other species' MC1R proteins. These include E. coli, yeast, baculovirus, and mammalian cell expression systems . The choice depends on research requirements - E. coli systems offer high yield but may lack post-translational modifications, while mammalian systems provide more native-like protein but with lower yields.

What functional assays can be used to evaluate recombinant MC1R activity?

Several complementary assays can be employed to assess recombinant MC1R functionality:

  • cAMP Accumulation Assays: Since MC1R signaling increases cAMP production via adenylate cyclase activation, measuring intracellular cAMP levels provides a direct readout of receptor function . ELISA-based cAMP detection kits or reporter gene assays (using CRE-luciferase constructs) can quantify receptor activation following stimulation with α-MSH or other agonists.

  • Ligand Binding Assays: Radioligand binding assays using labeled melanocortin peptides (e.g., 125I-labeled α-MSH) can determine binding affinity and receptor density. Saturation binding and competition assays help characterize pharmacological properties of wild-type versus mutant receptors.

  • Desensitization and Internalization Assessments: MC1R undergoes homologous desensitization following short exposure to agonists . This can be monitored using fluorescently-tagged receptors and confocal microscopy to track receptor localization before and after ligand exposure. Alternatively, western blotting of cell surface proteins after biotin labeling can quantify internalization rates.

  • Constitutive Activity Measurement: Since MC1R displays some degree of ligand-independent basal signaling , assays comparing cAMP levels between cells expressing MC1R and control cells in the absence of agonist can quantify constitutive activity. This is particularly relevant when assessing naturally occurring variants.

  • Dimerization Analysis: MC1R function depends on proper dimerization . Techniques such as bioluminescence resonance energy transfer (BRET) or co-immunoprecipitation can assess dimer formation between differentially tagged receptor constructs.

How should researchers approach studying adaptive MC1R variants in Chaetodipus populations?

Studying adaptive MC1R variation in Chaetodipus populations requires a comprehensive approach that integrates multiple methodologies:

  • Population Sampling Strategy: Collect samples from populations living on different substrate colors (e.g., light sandy soil versus dark volcanic rock), ensuring adequate geographical representation and sample sizes. The rock pocket mouse (C. intermedius) studies demonstrate the importance of comparing populations on different colored substrates to identify substrate-specific adaptations .

  • Association Studies: Conduct association studies between MC1R genotypes and coat color phenotypes. Carefully document coat color using standardized color charts or spectrophotometry. Statistical association between specific mutations and phenotypes should be assessed using methods such as the minimum redundancy maximum relevance (mRMR) algorithm, which can determine whether explanatory power for phenotypes lies primarily in coding regions and with nonsynonymous variants .

  • Sequence Analysis: Sequence the complete MC1R coding region (954 bp) in all sampled individuals. Analyze both synonymous and nonsynonymous polymorphisms, paying special attention to mutations in functional domains. In C. intermedius, four key amino acid polymorphisms (Arg-18→Cys, Arg-109→Trp, Arg-160→Trp, and Gln-233→His) were found to be associated with dark phenotypes in specific populations . Use similar approaches to identify potentially adaptive mutations in C. penicillatus.

  • Functional Validation: After identifying candidate mutations, validate their functional effects through in vitro expression and activity assays. Compare wild-type and mutant receptor signaling efficiency, ligand binding properties, and constitutive activity.

  • Geographic and Environmental Correlation: Analyze the distribution of MC1R variants in relation to environmental variables to test for signatures of selection. Geographic information systems (GIS) can help visualize and quantify relationships between genotype frequency and habitat characteristics.

What molecular evolutionary approaches are appropriate for analyzing MC1R evolutionary history in Chaetodipus species?

Several complementary molecular evolutionary approaches can elucidate the evolutionary history of MC1R in Chaetodipus:

How can researchers effectively investigate MC1R signaling pathways in Chaetodipus compared to model organisms?

Investigating MC1R signaling pathways in non-model organisms like Chaetodipus presents specific challenges that require adaptive methodological approaches:

  • Comparative Pathway Analysis: Begin by establishing baseline expectations based on well-characterized MC1R signaling in model organisms. Upon ligand binding, MC1R signals through G proteins to activate adenylate cyclase, increasing cAMP and ultimately affecting eumelanin production . Use this framework to design experiments testing conservation of this pathway in Chaetodipus.

  • Primary Cell Culture Development: Establish primary melanocyte cultures from Chaetodipus skin samples. While challenging, this approach allows for direct measurement of signaling in native cellular contexts. Protocols developed for rodent melanocyte isolation can be adapted, focusing on modifications to growth factors and culture conditions for pocket mouse cells.

  • Cross-Species Antibody Validation: Commercial antibodies developed for model organisms may recognize conserved epitopes in MC1R signaling components. Conduct thorough validation of antibodies targeting key pathway elements (MC1R, G proteins, adenylate cyclase, PKA) using western blotting with positive controls. Available MC1R antibodies with cross-species reactivity (e.g., those reacting with human and mouse) might be applicable .

  • Heterologous Expression Systems: Express Chaetodipus MC1R in established cell lines (HEK293, CHO) alongside known signaling components. This approach allows for controlled comparison of signaling efficiency between wild-type and variant receptors, or between Chaetodipus MC1R and those from model organisms.

  • Pharmacological Profiling: Characterize the response of Chaetodipus MC1R to various melanocortin peptides (α-MSH, β-MSH, ACTH) and synthetic agonists/antagonists. Compare EC50 values and maximal responses to determine if pharmacological properties differ from model organisms, potentially indicating adaptations in ligand recognition or G-protein coupling.

What experimental approaches are recommended for studying MC1R dimerization and trafficking in Chaetodipus?

MC1R functionality depends on proper dimerization, trafficking, and cell surface expression. The following approaches are recommended for studying these processes in Chaetodipus MC1R:

  • Protein-Protein Interaction Assays: MC1R undergoes constitutive dimerization without a ligand binding requirement at the level of the endoplasmic reticulum . To study this in Chaetodipus MC1R, employ co-immunoprecipitation, bioluminescence/fluorescence resonance energy transfer (BRET/FRET), or proximity ligation assays (PLA) with differentially tagged receptor constructs.

  • Disulfide Bond Analysis: MC1R homo-dimerization is dependent upon both covalent and non-covalent interactions, mediated by four inter-subunit disulfide bonds at specific cysteine residues . Perform site-directed mutagenesis of conserved cysteine residues in Chaetodipus MC1R to determine their role in dimerization and function. Non-reducing versus reducing SDS-PAGE can visualize disulfide-dependent dimers.

  • Trafficking Studies: MC1R trafficking from the ER to the plasma membrane is a regulated process. Use fluorescently-tagged MC1R constructs and confocal microscopy to track receptor localization in live cells. Endoplasmic reticulum and Golgi markers can help identify trafficking bottlenecks. Biotinylation assays can quantify surface expression levels.

  • Desensitization and Internalization: MC1R undergoes homologous desensitization following short exposure to α-MSH in a PKA-independent and G protein-coupled receptor kinase (GRK) dependent manner . To study this process, treat cells expressing Chaetodipus MC1R with α-MSH for various time periods and measure receptor phosphorylation, β-arrestin recruitment, and internalization rates using immunoblotting or microscopy techniques.

  • Protein Quality Control Analysis: Naturally occurring variants may affect receptor folding and quality control. Assess the interaction of wild-type versus variant Chaetodipus MC1R with chaperone proteins (e.g., BiP, calnexin) through co-immunoprecipitation or proximity-based assays to determine if melanistic mutations affect protein folding and trafficking.

What are common challenges in producing functional recombinant MC1R and how can they be addressed?

Producing functional recombinant MC1R presents several challenges that researchers should anticipate:

  • Low Expression Levels: As a membrane protein, MC1R often expresses poorly in heterologous systems. To address this:

    • Optimize codon usage for the expression system of choice

    • Include an N-terminal signal sequence (e.g., from rhodopsin or influenza hemagglutinin)

    • Test various cell lines (HEK293, CHO, SF9) to identify optimal expression systems

    • Consider inducible expression systems to minimize toxicity during cell growth

    • Include chemical chaperones (e.g., 4-phenylbutyric acid) in culture media to enhance folding

  • Protein Misfolding: G protein-coupled receptors like MC1R are prone to misfolding:

    • Reduce expression temperature (28-30°C instead of 37°C) to slow protein synthesis and improve folding

    • Include molecular chaperones (Hsp70, Hsp40) in co-expression systems

    • Test different detergents for membrane extraction (mild non-ionic detergents like DDM or LMNG)

    • Consider fusion partners that enhance folding (e.g., thioredoxin, maltose-binding protein)

  • Poor Functional Activity: Recombinant MC1R may express but show limited functionality:

    • Ensure the presence of essential post-translational modifications by using eukaryotic expression systems

    • Validate protein glycosylation status using PNGase F treatment

    • Test receptor in both dimerized and monomeric states, as MC1R dimerization affects function

    • Ensure cell lines have appropriate G protein subtypes for MC1R coupling

  • Difficult Purification: Membrane protein purification presents specific challenges:

    • Use affinity tags (His, FLAG, STREP) positioned to avoid interference with function

    • Implement two-step purification schemes (e.g., immobilized metal affinity chromatography followed by size exclusion)

    • Carefully optimize detergent concentration during solubilization and purification

    • Consider nanodiscs or amphipols for maintaining protein stability after purification

How can researchers address data inconsistencies when comparing MC1R function across different experimental systems?

When investigating MC1R function across different experimental systems, inconsistencies frequently arise. The following methodological approaches help address these challenges:

  • Standardization of Expression Systems:

    • Maintain consistent cell backgrounds by using the same cell line across experiments

    • Quantify receptor expression levels using surface ELISA or flow cytometry

    • Normalize functional data to receptor expression levels

    • Include standard controls (wild-type human or mouse MC1R) across all experiments

  • Assay Calibration:

    • Develop standard curves for each assay using reference agonists

    • Include dose-response relationships rather than single concentration points

    • Calculate relative efficacy compared to a standard agonist rather than absolute values

    • Use multiple, orthogonal assays to measure the same parameter (e.g., G protein activation)

  • Addressing Species-Specific Variation:

    • Test MC1R function in the context of species-matched G proteins when possible

    • Consider the influence of species-specific regulatory proteins (e.g., MRAP, ATRN)

    • Evaluate potential differences in post-translational modification machinery

    • Create chimeric receptors to identify domains responsible for functional differences

  • Statistical Approaches:

    • Implement mixed-effects models that account for between-experiment variability

    • Use Bland-Altman plots to visualize systematic differences between methods

    • Apply meta-analysis techniques to combine data from multiple experiments

    • Calculate minimum detectable differences to ensure adequate statistical power

  • Negative Controls and Validation:

    • Include MC1R variants with known loss-of-function (e.g., equivalent to human R variants)

    • Test system-specific artifacts using pharmacological inhibitors of different pathway components

    • Validate findings in primary cells when possible

    • Perform rescue experiments in knockout systems to confirm specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.