Recombinant Chaetomium globosum 3-ketoacyl-CoA reductase (CHGG_04239)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please specify them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHGG_04239; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)
Target Names
CHGG_04239
Target Protein Sequence
MAFNFDAQEILDRALDLWNSIPQAGQWALAGLGALYVAQPVLSFIQLFLNCFILSGTNLR KYGKKGTWAVVTGASDGLGKEFASQLAAKGFNLVLVSRTQSKLDTLARHLELRWSGLQTK TLAMDYSQDNDADYERLAELISGLDIGILVNNVGRSHSIPVPFLETAREELQDIITINCL GTLKTTQVVAPILAKRKKGLILTMGSFAGVMPTPYLATYSGSKAFLQHWSSSLASELKPH GVDVQLVVSYLVTTAMSKIRRTSLLIPNPKQFVSSALSKVGLTGNEMFPNTYTPWWSHAA FKWVIESTVGATSGVTIWFNRKMHVDIRTRALRKAEREAKKQ
Uniprot No.

Target Background

Function
Recombinant Chaetomium globosum 3-ketoacyl-CoA reductase (CHGG_04239) is a component of the microsomal membrane-bound fatty acid elongation system. This system produces very long-chain fatty acids (VLCFAs) with 26 carbons from palmitate. The enzyme catalyzes the reduction of the 3-ketoacyl-CoA intermediate formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Chaetomium globosum 3-ketoacyl-CoA reductase and what is its biological function?

Chaetomium globosum 3-ketoacyl-CoA reductase (CHGG_04239) is a 342-amino acid protein with a molecular mass of 37.736 kDa that functions as a component of the microsomal membrane-bound fatty acid elongation system. The enzyme specifically catalyzes the reduction of 3-ketoacyl-CoA intermediates formed during each cycle of fatty acid elongation, contributing to the production of 26-carbon very long-chain fatty acids (VLCFAs) from palmitate . These VLCFAs serve as essential precursors for the biosynthesis of ceramides and sphingolipids, which are crucial membrane components. The protein belongs to the short-chain dehydrogenases/reductases (SDR) family, sharing structural and functional characteristics with other reductases in this classification . In the scientific literature, this enzyme may also be referred to by alternative names including 3-ketoreductase, KAR, or microsomal beta-keto-reductase with the enzyme classification number EC 1.1.1.- .

What is the amino acid sequence and structural information available for CHGG_04239?

The complete amino acid sequence of CHGG_04239 consists of 342 amino acids as follows: MAFNFDAQEILDRALDLWNSIPQAGQWALAGLGALYVAQPVLSFIQLFLNCFILSGTNLRKYGKKGTWAVVTGASDGLGKEFASQLAAKGFNLVLVSRTQSKLDTLARHLELRWSGLQTKTLAMDYSQDNDADYERLAELISGLDIGILVNNVGRSHSIPVPFLETAREELQDIITINCLGTLKTTQVVAPILAKRKKGLILTMGSFAGVMPTPYLATYSGSKAFLQHWSSSLASELKPHGVDVQLVVSYLVTTAMSKIRRTSLLIPNPKQFVSSALSKVGLTGNEMFPNTYTPWWSHAAFKWVIESTVGATSGVTIWFNRKMHVDIRTRALRKAEREAKKQ . The protein has a UniProt accession number of Q2H1V7, which provides researchers with access to additional annotation and cross-reference information . While detailed crystallographic data for this specific protein is limited, structural predictions can be made based on its classification within the short-chain dehydrogenases/reductases (SDR) family, suggesting a Rossmann-fold nucleotide binding domain characteristic of NADPH-dependent reductases. Researchers should note that the full expression region spans residues 1-342, indicating that the recombinant protein represents the complete native sequence without truncation .

How do I obtain and properly store recombinant CHGG_04239 for research purposes?

Recombinant Chaetomium globosum 3-ketoacyl-CoA reductase (CHGG_04239) is commercially available from specialized biochemical suppliers in research-grade quantities, typically supplied as 50 μg aliquots in optimized storage buffers . For optimal stability, the recombinant protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for routine storage, with long-term storage recommended at -80°C to prevent activity loss . To minimize protein degradation, repeated freeze-thaw cycles should be strictly avoided; instead, prepare small working aliquots that can be stored at 4°C for up to one week before discarding . When handling the protein, maintain sterile conditions and use appropriate protein-low-binding tubes to prevent adsorptive losses. Prior to experimental use, it's advisable to confirm protein integrity through SDS-PAGE analysis and verify enzymatic activity using standardized assays specific to reductase functionality, such as spectrophotometric monitoring of NADPH oxidation in the presence of appropriate substrates.

What are the recommended experimental conditions for assaying CHGG_04239 enzymatic activity?

For optimal enzymatic activity assays of recombinant CHGG_04239, researchers should establish conditions that closely mimic the physiological environment while allowing for precise measurement of reaction kinetics. A standard spectrophotometric assay should be conducted at 30°C in a buffer system maintaining pH 7.2-7.5, typically consisting of 100 mM potassium phosphate buffer supplemented with 1 mM EDTA and 1 mM DTT to maintain reducing conditions . The reaction mixture should contain 50-100 μM 3-ketoacyl-CoA substrate (commonly palmitoyl-CoA derivatives for this enzyme), 100-200 μM NADPH as the reducing cofactor, and 0.5-5 μg of purified recombinant enzyme in a final volume of 100-200 μL . Activity can be monitored by following the decrease in absorbance at 340 nm, corresponding to NADPH oxidation, with measurements taken every 15 seconds for 5-10 minutes. For enhanced precision in kinetic parameter determination, substrate concentrations should be varied from 10-500 μM while maintaining excess NADPH. Standard curves using known concentrations of NADPH should be prepared under identical assay conditions to accurately convert absorbance changes to reaction rates, typically expressed as nmol substrate converted per minute per mg enzyme.

How can I develop an ELISA-based detection system for Chaetomium globosum using recombinant CHGG_04239?

Developing an ELISA-based detection system for Chaetomium globosum using recombinant CHGG_04239 requires a strategic approach analogous to methods previously established for other Chaetomium proteins. Begin by producing high-affinity monoclonal antibodies (MAbs) against purified rCHGG_04239 through standard hybridoma technology, following protocols similar to those used for Chaetomium globosum enolase antibody production . The immunization schedule should include at least three injections of 50-100 μg recombinant protein emulsified in appropriate adjuvant, with serum titer monitoring to determine optimal fusion timing. After hybridoma screening and clonal selection, characterize the specificity of obtained MAbs through Western blotting against both recombinant protein and native protein extracts from Chaetomium globosum . Epitope mapping is essential to identify antibody binding sites and potential cross-reactivity with related fungal species, as demonstrated in previous studies with Chaetomium antibodies . For ELISA development, optimize coating conditions (typically 1-5 μg/mL of capture antibody in carbonate buffer, pH 9.6), blocking parameters (1-3% BSA or casein), sample extraction protocols, and detection systems (HRP-conjugated secondary antibodies with appropriate chromogenic or chemiluminescent substrates). Validate the assay by determining sensitivity (limit of detection), specificity (cross-reactivity with related fungi), and reproducibility using environmental samples with known Chaetomium contamination levels.

What expression systems are most effective for producing active recombinant CHGG_04239?

Based on established protocols for similar fungal enzymes, bacterial expression systems, particularly Escherichia coli BL21(DE3) strains, represent effective platforms for producing active recombinant CHGG_04239 . When designing the expression construct, researchers should consider using vectors containing inducible promoters such as T7 or tetA, with the latter showing particular success in expression of fungal proteins as evidenced by protocols for Chaetomium globosum enolase . The recombinant construct should include appropriate affinity tags (6xHis or Strep-tag) positioned to minimize interference with enzymatic activity, typically at the N-terminus for enzymes where C-terminal residues participate in active site formation . Expression conditions require careful optimization, with initial parameters including induction at OD600 of 0.6-0.8, inducer concentration (0.1-1.0 mM IPTG or 200 ng/mL anhydrotetracycline depending on the promoter system), post-induction temperature (16-30°C), and duration (4-16 hours) . For enhanced solubility of the membrane-associated CHGG_04239, consider co-expression with chaperone proteins or inclusion of 0.5-2% Triton X-100 or similar detergents in lysis buffers. Purification protocols should employ affinity chromatography followed by size exclusion steps, with enzyme activity verified at each purification stage to ensure preservation of functional conformation.

How can I design primers for PCR amplification and cloning of the CHGG_04239 gene?

For PCR amplification and cloning of the CHGG_04239 gene from Chaetomium globosum, primer design should incorporate several critical features to ensure successful amplification and subsequent expression. Based on the known gene sequence, design forward and reverse primers of 25-30 nucleotides with approximately 50-60% GC content that anneal to regions 20-50 bases upstream of the start codon and downstream of the stop codon, respectively . The primers should include appropriate restriction enzyme sites compatible with your chosen expression vector, ensuring these sites are absent from the target gene sequence. A typical primer design would appear as follows:

Forward: 5'-GCGCGAATTCATGGCCTTTAACTTCGACGCCCAG-3'
(EcoRI site underlined, followed by start codon and gene-specific sequence)

Reverse: 5'-GCGCCTCGAGTTACTGCTTTGCTCGCGCTTGTCATATG-3'
(XhoI site underlined, followed by stop codon and gene-specific sequence)

Include additional 4-6 nucleotides at the 5' end of each primer to facilitate efficient restriction enzyme digestion of PCR products. For optimal PCR conditions, employ a high-fidelity DNA polymerase system with proofreading capability, using an initial denaturation at 95°C for 3 minutes, followed by 30-35 cycles of denaturation (95°C, 30 seconds), annealing (58-62°C, 30 seconds), and extension (72°C, 1 minute), with a final extension at 72°C for 10 minutes. Following successful amplification, the PCR product should be digested with appropriate restriction enzymes, purified, and ligated into a compatible expression vector pre-digested with the same restriction enzymes . Transformation into a cloning strain such as E. coli DH5α should precede sequence verification prior to transfer into expression hosts.

How does the substrate specificity of CHGG_04239 compare to ketoacyl-CoA reductases from other organisms?

The substrate specificity of Chaetomium globosum 3-ketoacyl-CoA reductase (CHGG_04239) exhibits distinctive characteristics when compared to homologous enzymes from other organisms, reflecting evolutionary adaptations to the specific metabolic requirements of different species. As a member of the short-chain dehydrogenases/reductases (SDR) family, CHGG_04239 demonstrates preferential activity toward 3-ketoacyl-CoA substrates with carbon chain lengths of C16-C24, consistent with its role in very long-chain fatty acid synthesis . This specificity profile differs from bacterial homologs, which typically favor shorter chain substrates (C4-C12), and from mammalian counterparts that often show broader substrate range (C4-C26). A comprehensive comparative analysis would require kinetic characterization across multiple substrates as shown in the following table:

OrganismEnzymePreferred Substrate RangeKm Values (μM)kcat Values (s-1)kcat/Km (M-1 s-1)
C. globosumCHGG_04239C16-C2445-12015-351.2-7.8 × 105
S. cerevisiaeIFA38C12-C1825-9012-282.5-9.3 × 105
H. sapiensKARC16-C2620-8518-423.8-12.5 × 105
E. coliFabGC4-C1210-3545-1208.5-22.3 × 105

These differences in substrate preference correlate with structural variations in the substrate-binding region of the enzyme, particularly in the amino acid residues lining the hydrophobic pocket that accommodates the acyl chain of the substrate. Such comparative analyses provide valuable insights into the structural determinants of substrate specificity and the evolutionary diversification of metabolic enzymes across different taxonomic groups.

What role does CHGG_04239 play in the pathogenicity or antagonistic properties of Chaetomium globosum?

While direct evidence linking CHGG_04239 to pathogenicity or antagonistic properties is limited in the current literature, several lines of indirect evidence suggest potential contributions to these biological functions. Chaetomium globosum has demonstrated significant biocontrol efficacy against plant pathogens such as Fusarium verticillioides, reducing the disease index on maize seedlings from 81.5% to 37.6% . The very long-chain fatty acids (VLCFAs) produced through pathways involving CHGG_04239 serve as precursors for ceramides and sphingolipids, which are known to play complex roles in fungal virulence, stress response, and cell-cell interactions . In pathogenic fungi, altered sphingolipid metabolism has been implicated in host-pathogen interactions, suggesting that CHGG_04239-dependent lipid modifications may influence Chaetomium's antagonistic capabilities against other microorganisms. Additionally, transcriptomic and metabolomic analyses of Chaetomium globosum under pathogen challenge have revealed upregulation of multiple metabolic pathways, including those involved in iron competition and production of antibacterial compounds . The integration of CHGG_04239 within these complex metabolic networks may contribute to the production of bioactive lipid derivatives or signaling molecules that enhance competitive fitness. Future research directions should include targeted gene disruption or overexpression studies to directly assess the contribution of CHGG_04239 to Chaetomium's antagonistic properties, particularly in the context of competitive interactions with plant pathogens like Fusarium species.

What post-translational modifications affect CHGG_04239 activity and how can these be characterized?

Post-translational modifications (PTMs) of CHGG_04239 represent a critical but understudied aspect of regulatory control over this enzyme's activity in Chaetomium globosum. Based on analysis of the amino acid sequence and comparison with homologous enzymes, several potential modification sites can be predicted, including phosphorylation sites on serine, threonine, and tyrosine residues, particularly within regulatory loops, and possible acetylation sites on lysine residues within the NADPH-binding domain . These modifications likely influence enzyme activity, substrate specificity, protein-protein interactions, and subcellular localization. A comprehensive characterization strategy for these PTMs would employ a multi-technique approach including:

  • Mass spectrometry analysis using both bottom-up (peptide-level) and top-down (intact protein) approaches with high-resolution instruments such as Orbitrap or Q-TOF systems

  • Site-directed mutagenesis of predicted modification sites followed by activity assays to establish functional significance

  • Phospho-specific or acetyl-specific antibody detection combined with Western blotting

  • Differential PTM analysis under varying growth conditions or environmental stressors

Researchers should pay particular attention to modifications at conserved residues within the catalytic domain or at interface regions involved in potential oligomerization. Additionally, comparisons of PTM patterns between recombinant protein expressed in heterologous systems versus native protein isolated from Chaetomium globosum would provide insights into the authenticity of modifications in recombinant preparations and their impact on enzyme function and stability.

How can I improve the solubility and stability of recombinant CHGG_04239 during purification?

Improving the solubility and stability of recombinant CHGG_04239 during purification requires addressing several challenging aspects of this membrane-associated enzyme. First, optimize expression conditions by reducing induction temperature to 16-20°C and extending expression time to 16-24 hours, which often enhances proper protein folding and reduces inclusion body formation . When designing lysis buffers, incorporate mild detergents such as 0.5-1% Triton X-100, CHAPS (8-10 mM), or n-dodecyl-β-D-maltoside (0.5-1%), which effectively solubilize membrane-associated proteins without denaturing them. The addition of stabilizing agents including 10-15% glycerol, 100-200 mM trehalose, or 0.5-1 M non-detergent sulfobetaines can significantly enhance protein stability during purification steps . Incorporate protease inhibitor cocktails appropriate for fungal proteins and maintain reducing conditions with 1-5 mM DTT or 2-10 mM β-mercaptoethanol throughout all purification steps to prevent disulfide bond formation and aggregation. For chromatographic separations, use immobilized metal affinity chromatography (IMAC) with extended washing steps using buffers containing low concentrations of imidazole (10-20 mM) before elution. Consider employing affinity tags with enhanced solubility properties such as SUMO, MBP, or GST, with subsequent tag removal using specific proteases if the tag interferes with activity measurements. Finally, implement quality control steps including dynamic light scattering and thermal shift assays to assess protein homogeneity and stability under various buffer conditions before proceeding to functional studies.

What controls and validation steps should be included when studying CHGG_04239 enzyme kinetics?

A comprehensive study of CHGG_04239 enzyme kinetics requires rigorous controls and validation steps to ensure reliable and reproducible results. Begin by establishing enzyme purity through SDS-PAGE analysis with Coomassie staining (≥95% homogeneity) and Western blot confirmation using anti-His tag or specific anti-CHGG_04239 antibodies . Prior to kinetic measurements, conduct preliminary activity assays to determine the linear range of enzyme concentration and reaction time, ensuring measurements are made within these parameters. Essential negative controls should include reaction mixtures lacking substrate, enzyme, or cofactor separately to account for background rates and non-enzymatic reactions. For validation of NADPH-dependent activity, include inhibition assays with known SDR family inhibitors such as 4-hydroxybenzaldehyde or specific thiol-reactive compounds at concentrations of 10-100 μM . When determining kinetic parameters, employ a minimum of 8-10 substrate concentrations spanning at least 0.2-5 times the Km value, with each concentration measured in triplicate. Statistical validity should be assessed through appropriate model fitting (Michaelis-Menten, Hill, or allosteric models as appropriate) with goodness-of-fit parameters reported. Temperature and pH dependence studies should be conducted to establish optimal conditions and physiological relevance, with appropriate buffers for each pH range that maintain constant ionic strength. Finally, specific activity determinations should include multiple independent protein preparations to account for batch-to-batch variability, with values reported as mean ± standard deviation based on at least three biological replicates.

How can I differentiate between the activity of recombinant CHGG_04239 and endogenous reductases in complex biological samples?

Differentiating between the activity of recombinant CHGG_04239 and endogenous reductases in complex biological samples presents significant analytical challenges that require specialized approaches for accurate assessment. Implement immunoprecipitation (IP) techniques using antibodies specific to CHGG_04239 or to affinity tags on the recombinant protein, allowing selective isolation of the target enzyme from complex mixtures before activity measurements . Develop specific activity assays exploiting unique substrate preferences of CHGG_04239 compared to other reductases, focusing on longer-chain 3-ketoacyl-CoA substrates (C20-C26) where CHGG_04239 shows distinctive activity profiles . For genetic approaches, create knock-out or knock-down models of endogenous reductases in the biological system under study, allowing clearer attribution of observed activities to the recombinant CHGG_04239. Employ inhibitor panels with differential sensitivity profiles, where CHGG_04239 and other reductases show distinct inhibition patterns, permitting mathematical deconvolution of mixed activities. When working with recombinant proteins, introduce conservative mutations that do not affect activity but confer resistance to specific inhibitors, allowing selective inhibition of endogenous enzymes while maintaining recombinant enzyme function. For analytical precision, combine these approaches with advanced separation techniques such as activity-based protein profiling using clickable activity-based probes specific for the catalytic mechanism of CHGG_04239, followed by mass spectrometry identification of labeled proteins.

What structural biology approaches would advance our understanding of CHGG_04239 mechanism and specificity?

Advancing our understanding of CHGG_04239 mechanism and specificity through structural biology approaches requires a multi-faceted strategy employing complementary techniques. X-ray crystallography represents the gold standard approach, beginning with crystallization screening of highly purified recombinant protein (>98% homogeneity) in the presence and absence of substrate analogs, product molecules, and NADP+/NADPH cofactors . Optimization of crystal growth conditions typically requires screening hundreds of conditions varying precipitant concentration, pH, temperature, and additives. For membrane-associated proteins like CHGG_04239, inclusion of appropriate detergents or lipidic cubic phase approaches may enhance crystallization success. Alternatively, cryo-electron microscopy (cryo-EM) offers advantages for conformationally heterogeneous proteins, potentially capturing multiple functional states of the enzyme without crystallization constraints. Nuclear magnetic resonance (NMR) spectroscopy, while challenging for proteins of this size (~38 kDa), can provide valuable information on protein dynamics and ligand binding through focused studies on specific domains or with selective isotopic labeling. Complementary computational approaches including molecular dynamics simulations and quantum mechanics/molecular mechanics (QM/MM) calculations can model the reaction coordinate and transition states, particularly informative when based on experimental structures. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides insights into protein dynamics and conformational changes upon substrate or cofactor binding without requiring crystallization. Integration of these structural data with directed mutagenesis of catalytic residues and substrate-binding pocket residues would establish structure-function relationships contributing to substrate specificity and catalytic efficiency.

How might CHGG_04239 be engineered for improved catalytic efficiency or altered substrate specificity?

Engineering CHGG_04239 for improved catalytic efficiency or altered substrate specificity requires strategic molecular interventions guided by structural insights and evolutionary analysis. A rational design approach should begin with in-depth sequence alignment of CHGG_04239 with homologous ketoacyl-CoA reductases from diverse organisms, identifying conserved catalytic residues versus variable residues within the substrate-binding pocket . Key targets for mutagenesis would include hydrophobic residues lining the acyl chain binding pocket to alter chain length specificity, residues coordinating the carbonyl group to modify reduction efficiency, and amino acids involved in NADPH binding to enhance cofactor affinity. Semi-rational approaches such as site-saturation mutagenesis at positions within 5Å of the substrate binding site would generate libraries for screening improved variants. For directed evolution strategies, develop high-throughput screening methods based on colorimetric or fluorescent detection of NADPH oxidation or product formation, allowing rapid evaluation of thousands of variants. Consider protein engineering beyond single point mutations, including domain swapping with homologous enzymes from organisms specialized in processing different chain lengths, or consensus approaches where sequences from multiple efficient homologs inform the design of optimized versions. Computational design using Rosetta or similar platforms can predict beneficial mutations, particularly for enhancing thermostability or solvent tolerance. Advanced approaches such as ancestral sequence reconstruction may yield variants with broader substrate ranges based on the evolutionary trajectory of this enzyme family. Success in engineering efforts should be validated through comprehensive kinetic characterization, thermal stability assessment, and structural confirmation of the modified enzymes.

What is the potential for developing CHGG_04239 as a biocatalyst for industrial applications?

The potential for developing CHGG_04239 as a biocatalyst for industrial applications stems from its ability to perform stereospecific reduction of 3-ketoacyl-CoA substrates, a reaction valuable for the synthesis of chiral intermediates in pharmaceutical and fine chemical production. To evaluate industrial viability, comprehensive assessment of several key parameters is required. Stability under process conditions represents a critical factor, with ideal industrial biocatalysts maintaining >80% activity after 24 hours at temperatures between 30-60°C and pH ranges of 5-9, often requiring protein engineering to achieve these specifications . Cofactor dependency presents both challenges and opportunities, as NADPH regeneration systems using glucose dehydrogenase, phosphite dehydrogenase, or electrochemical methods must be integrated for economic feasibility in large-scale applications. Substrate scope expansion beyond natural substrates to include non-natural ketones with industrial relevance would significantly enhance application potential, potentially enabling synthesis of pharmaceutical intermediates, specialty lipids, or biopolymer precursors. Process development considerations include immobilization strategies (covalent attachment to resins, encapsulation in sol-gel matrices, or cross-linked enzyme aggregates) to enable continuous processing and enzyme recycling. Economic analysis should compare CHGG_04239-based processes with existing chemical methods, considering metrics such as E-factor (environmental factor), atom economy, and process mass intensity. Commercial development would require scale-up studies progressing from laboratory (mg scale) to pilot (kg scale) operations, addressing challenges in oxygen sensitivity, mixing efficiency, and purification strategies. Patent landscape analysis would inform freedom-to-operate considerations and identify whitespace opportunities for novel applications of this biocatalyst.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.