Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
STRING: 306901.XP_001226102.1
AIM31/Rcf1 is a member of the conserved hypoxia-induced gene 1 (Hig1) protein family that functions as a component of the yeast cytochrome bc1-COX supercomplex in mitochondria. Originally discovered in a screen designed to identify genes encoding proteins whose absence caused altered inheritance of mitochondrial DNA (AIM), AIM31 was later recognized for its critical role in respiratory function . The protein is highly conserved across species, indicating its evolutionary importance in mitochondrial function. In Chaetomium globosum, this 223-amino acid protein (full-length) plays an essential role in cellular respiration and energy metabolism . The protein's conservation across fungal species suggests it serves a fundamental role in eukaryotic energy production systems.
Recombinant AIM31 from Chaetomium globosum (strain ATCC 6205) is expressed as a full-length protein consisting of 223 amino acids. The protein contains specific structural domains that facilitate its interaction with the respiratory chain complexes. The amino acid sequence (MSDRPTQGLTWGPRRDFYNESGSQKIIRKLKEEPLVPIGCILTIAAFTNAYRAMRRGDHH KVQRMFRARVAAQGFTVLAMVGGGMYYAEDRNKRKELGKLKQQQEAEEKRQKWIRELEAR DEEEKALQEMMDKKRKRASERTMRAETGSEGIAAQARAAFKDKANKGEAAGAEKTEAPSQ RADNEKKPAGSGFLGGWFGGSSKTPETPAKDTKGKNLDSESSS) contains regions that enable its binding to both cytochrome bc1 and cytochrome c oxidase (COX) components of the respiratory chain supercomplex . When produced as a recombinant protein, it typically includes an N-terminal 10xHis-tag that facilitates purification and detection in experimental settings .
AIM31/Rcf1 functions as a bridge component in the cytochrome bc1-COX supercomplex, where it physically associates with both enzyme complexes but demonstrates a tighter binding affinity to the COX complex . It appears to be particularly important for the assembly and stability of peripheral COX subunits, notably Cox12 and Cox13. The protein exhibits a close physical relationship with the Cox3 protein, suggesting a role in stabilizing this subunit within the larger complex .
Research indicates that AIM31/Rcf1 works cooperatively with another mitochondrial protein, Aim38 (renamed Rcf2), with which it shares limited sequence similarity. Together, these proteins contribute to the proper assembly and function of the respiratory supercomplex, enhancing the efficiency of electron transfer between complexes and optimizing cellular respiration .
For isolation and purification of recombinant AIM31, researchers should implement a comprehensive protocol leveraging the His-tag fusion design. The recommended method includes:
Expression in an E. coli system using a vector containing the full AIM31 sequence (amino acids 1-223) with an N-terminal 10xHis-tag
Cell lysis under native conditions using a buffer containing mild detergents
Initial purification via immobilized metal affinity chromatography (IMAC) using Ni-NTA resin
Secondary purification through size exclusion chromatography
Buffer exchange to a Tris/PBS-based buffer (pH 8.0) with 6% trehalose for stability
For studies requiring analysis of AIM31's interaction with respiratory complexes, it's essential to maintain the native conformation during purification. Researchers should employ mild detergents such as digitonin, which has proven effective in maintaining the integrity of the cytochrome bc1-COX supercomplex during purification procedures .
To effectively study AIM31/Rcf1's interactions with respiratory chain complexes, researchers should consider a multi-technique approach:
Blue Native PAGE (BN-PAGE) - This has proven highly effective for visualizing intact respiratory supercomplexes. Studies have successfully identified AIM31/Rcf1 as a component of the cytochrome bc1-COX supercomplex using this technique .
Affinity Purification with Tagged Components - Using histidine-tagged cytochrome c1 and Aac2 derivatives under mild digitonin solubilization conditions preserves supercomplex organization while allowing co-purification of AIM31/Rcf1 .
Mass Spectrometry Analysis - This technique is crucial for confirming the identity of AIM31/Rcf1 in purified complexes and identifying post-translational modifications that may regulate function .
Co-immunoprecipitation - Allows investigation of specific protein-protein interactions, particularly the reported close interaction between AIM31/Rcf1 and Cox3.
Crosslinking Studies - These can provide detailed information about the spatial arrangement of AIM31/Rcf1 within the supercomplex architecture.
For optimal results, researchers should maintain native-like conditions throughout sample preparation to preserve the integrity of these delicate protein interactions.
Designing effective loss-of-function experiments for AIM31 requires careful consideration of compensatory mechanisms, particularly the functional overlap with Aim38/Rcf2. Based on the research data, the following methodological approach is recommended:
Single vs. Double Knockouts - Create both single AIM31 knockouts and AIM31/Aim38 double knockouts, as research indicates that significant impact on COX enzyme activity and assembly of peripheral COX subunits (Cox12 and Cox13) is observed only when both proteins are absent .
Respiratory Capacity Assessment - Measure oxygen consumption rates in intact cells and isolated mitochondria to quantify the impact on respiratory function.
BN-PAGE Analysis - Examine supercomplex assembly status using blue native gel electrophoresis to visualize changes in complex formation.
Activity Assays - Implement specific enzyme activity assays for cytochrome c oxidase to measure functional consequences of AIM31 deletion.
Microscopy Techniques - Use fluorescence microscopy with appropriate mitochondrial dyes to assess changes in mitochondrial morphology and distribution.
When interpreting results, researchers should consider that AIM31 and Aim38 may independently bind to the cytochrome bc1-COX supercomplex, and phenotypes may be evident only when both proteins are absent .
AIM31/Rcf1 plays a critical role in the formation and stability of respiratory supercomplexes, particularly the cytochrome bc1-COX supercomplex. Research evidence indicates that AIM31/Rcf1, together with Aim38/Rcf2, functions as a bridge or stabilizing factor that supports the assembly of the supercomplex state .
The protein demonstrates dual binding capability, interacting with both the cytochrome bc1 complex and the COX enzyme domains, though it exhibits a stronger association with the COX complex. Within the COX complex, AIM31/Rcf1 displays a close physical relationship with the Cox3 protein, suggesting a role in anchoring this subunit within the larger complex structure .
Experimental evidence from deletion studies reveals that the absence of both AIM31/Rcf1 and Aim38/Rcf2 (but not the absence of either alone) significantly impacts:
These findings support the hypothesis that AIM31/Rcf1 acts as an architectural component that helps establish the correct spatial arrangement of respiratory complexes, optimizing electron transfer efficiency between components of the respiratory chain .
AIM31/Rcf1's classification as a member of the hypoxia-induced gene 1 (Hig1) protein family suggests a potential role in cellular responses to low oxygen conditions . This relationship merits further investigation, as the connection between mitochondrial respiratory function and hypoxia adaptation represents an important area of research.
Several hypotheses can be considered when investigating this relationship:
AIM31/Rcf1 may contribute to respiratory chain remodeling under low oxygen conditions, potentially optimizing electron transfer efficiency when oxygen is limited.
As a component that influences COX activity, AIM31/Rcf1 might participate in regulating oxygen consumption rates in response to varying oxygen availability.
The protein could function in signaling pathways that communicate mitochondrial oxygen utilization status to nuclear gene expression programs.
Research methodologies to explore this relationship should include:
Gene expression analysis under varying oxygen tensions
Comparative phenotypic analysis of wild-type and AIM31-deficient strains under normoxic versus hypoxic conditions
Investigation of potential post-translational modifications of AIM31/Rcf1 in response to oxygen limitation
Proteomic analysis of interaction partners under different oxygen conditions
Understanding this relationship could provide insights into fundamental cellular adaptation mechanisms to environmental stress conditions.
Structural analyses of AIM31/Rcf1 are essential for elucidating its precise molecular mechanism within the respiratory supercomplex. While detailed structural information is not explicitly provided in the search results, researchers can employ several approaches to gain structural insights:
X-ray Crystallography or Cryo-EM - These techniques could reveal the three-dimensional structure of AIM31/Rcf1, either in isolation or, ideally, in complex with its interaction partners within the respiratory supercomplex.
Structure-Function Correlation - By mapping functional domains to the structural features, researchers can identify regions critical for protein-protein interactions, particularly those mediating binding to the cytochrome bc1 and COX complexes.
Molecular Dynamics Simulations - These computational approaches can help predict how AIM31/Rcf1 dynamically interacts with other components of the supercomplex under various conditions.
Structural Comparison with Other Hig1 Family Members - Comparative analysis could reveal conserved structural elements that underpin the functional importance of this protein family in mitochondrial respiration.
By integrating structural data with functional studies, researchers can develop more precise models of how AIM31/Rcf1 contributes to supercomplex assembly and stability, potentially identifying specific interaction interfaces that could be targeted in future studies or therapeutic approaches.
When designing experiments to study AIM31/Rcf1 function in respiratory complexes, researchers should implement a comprehensive set of controls to ensure valid interpretation of results:
Genetic Controls:
Single deletion mutants (ΔAIM31)
Double deletion mutants (ΔAIM31ΔAIM38)
Complemented strains (ΔAIM31 + AIM31)
Point mutants affecting key functional residues
Wild-type reference strain
Functional Controls:
Analysis of known respiratory complex components (e.g., COX and cytochrome bc1 subunits)
Measurement of general mitochondrial function parameters
Assessment of mitochondrial morphology and distribution
Biochemical Controls:
Environmental Controls:
Variation of growth conditions (carbon source, oxygen levels)
Temperature sensitivity tests
Stress response assays
The research indicates that AIM31/Rcf1 functions may be partially redundant with Aim38/Rcf2, making it particularly important to include the double deletion mutant in experimental designs to observe the most pronounced phenotypes .
The functional redundancy between AIM31/Rcf1 and Aim38/Rcf2 presents a significant experimental consideration that must be systematically addressed. Based on the research findings, loss of both proteins (but not loss of either individually) significantly impacts COX enzyme activity and assembly of peripheral subunits . To properly account for this redundancy, researchers should:
Implement a Genetic Series Approach:
Create and analyze single mutants (ΔAIM31 and ΔAIM38)
Create and analyze the double mutant (ΔAIM31ΔAIM38)
Develop complementation strains with controlled expression levels
Design Quantitative Assays:
Measure respiratory complex activity across all genetic backgrounds
Quantify supercomplex assembly efficiency using BN-PAGE followed by densitometry
Assess growth rates under conditions requiring respiratory function
Employ Dose-Response Analyses:
Use regulated promoters to vary expression levels of each protein
Determine threshold levels required for function
Assess whether overexpression of one protein can compensate for loss of the other
Investigate Domain-Specific Functions:
Create chimeric proteins containing domains from both AIM31 and AIM38
Test whether specific domains confer functional specificity or overlap
This comprehensive approach will help distinguish between shared and unique functions of these proteins, providing a more complete understanding of their roles in mitochondrial respiration.
When extending AIM31/Rcf1 research to different fungal species, researchers should consider several important factors to ensure meaningful comparative analyses:
Evolutionary Conservation Assessment:
Conduct bioinformatic analyses to identify true orthologs across species
Examine sequence conservation in functional domains
Consider potential neofunctionalization or subfunctionalization events
Model System Selection:
Choose representative species from diverse fungal lineages
Include both model organisms with established genetic tools and non-model fungi of ecological or industrial significance
Consider species with different respiratory strategies (obligate aerobes vs. facultative anaerobes)
Standardized Experimental Conditions:
Develop consistent growth and assay conditions that are physiologically relevant for each species
Account for natural variation in mitochondrial function and organization
Establish appropriate normalization methods for cross-species comparisons
Complementation Studies:
Test cross-species functional complementation (e.g., can Chaetomium globosum AIM31 complement a Saccharomyces cerevisiae Rcf1 deletion?)
Identify species-specific interacting partners
Consideration of Ecological Context:
This approach will help establish whether AIM31's role in respiratory supercomplex formation represents a conserved function across fungi or if the protein has adapted to serve species-specific requirements.
Interpreting changes in respiratory complex activity when studying AIM31/Rcf1 requires careful consideration of multiple factors. Based on the research data, the following analytical framework is recommended:
Distinguish Direct vs. Indirect Effects:
Primary effects: Changes directly attributable to AIM31's role in complex assembly or stability
Secondary effects: Downstream consequences that may reflect compensatory mechanisms
Consider Redundancy Factors:
Analyze Specific Complex Components:
Quantify Supercomplex vs. Individual Complex Activities:
Measure the activities of isolated complexes compared to intact supercomplexes
Assess electron transfer efficiency between complexes
Establish Correlation Between Structure and Function:
Correlate changes in supercomplex assembly (as visualized by BN-PAGE) with functional measurements
Use respiratory control ratios and P/O ratios to assess coupling efficiency
When interpreting data, researchers should recognize that AIM31/Rcf1 appears to have a primary role in supercomplex organization rather than being a catalytic component itself, meaning that effects on respiratory activity likely reflect altered complex interactions rather than direct enzymatic changes .
When analyzing functional data related to AIM31/Rcf1, researchers should employ statistical approaches that account for the biological complexity of mitochondrial function and the potential for variable phenotypes. Recommended statistical methods include:
For Comparing Multiple Genetic Backgrounds:
Analysis of Variance (ANOVA) followed by appropriate post-hoc tests (Tukey's HSD or Dunnett's test when comparing to a control)
Consider using Mixed Effects Models when accounting for both fixed factors (genotype) and random factors (experimental batch)
For Respiratory Complex Activity Data:
Repeated measures designs to account for time-dependent changes
Non-parametric alternatives (Kruskal-Wallis) when normality assumptions are violated
Bootstrap methods for generating confidence intervals with small sample sizes
For Supercomplex Assembly Analysis:
Quantitative image analysis of BN-PAGE with appropriate normalization
Ratio-based statistics comparing the proportions of free complexes versus assembled supercomplexes
For Multi-Parameter Phenotypic Analysis:
Principal Component Analysis (PCA) or other dimension reduction techniques
Hierarchical clustering to identify patterns across multiple phenotypic parameters
For Establishing Structure-Function Relationships:
Correlation analyses between structural measurements and functional outcomes
Regression models to quantify relationships between protein levels and functional readouts
In all cases, researchers should report effect sizes alongside p-values, as the magnitude of changes in mitochondrial function can be as informative as statistical significance. Additionally, power analyses should be conducted to ensure adequate sample sizes, particularly when studying the potentially subtle effects of single versus double deletions of AIM31 and AIM38.
Differentiating between AIM31/Rcf1's roles in complex assembly versus direct functional effects requires a systematic experimental approach and careful data interpretation. Based on the research findings, the following strategies are recommended:
Temporal Analysis of Complex Formation:
Implement time-course studies using inducible expression systems
Track the kinetics of supercomplex assembly following AIM31 induction
Compare with the timeline of functional recovery
Structural vs. Functional Measurements:
Quantify structural parameters (complex assembly via BN-PAGE) in parallel with functional measurements (enzyme activity, oxygen consumption)
Calculate correlation coefficients between structural and functional parameters
Look for temporal dissociations that might indicate separate roles
Domain-Specific Mutations:
Create a series of mutants targeting specific domains of AIM31
Identify mutations that affect assembly but not function, or vice versa
Use these to map structure-function relationships
Distinguishing Effects on Individual Complexes:
Measure the activities and assembly status of both cytochrome bc1 and COX complexes independently
Determine whether effects on one complex precede effects on the other
Electron Transfer Kinetics:
Use stopped-flow techniques to measure electron transfer rates between complexes
Determine whether AIM31 affects the efficiency of electron transfer independent of complex assembly
The research data indicates that AIM31/Rcf1 likely functions primarily in supercomplex organization, with effects on respiratory function being a consequence of altered complex assembly rather than direct catalytic roles . This is supported by the observation that AIM31/Rcf1 and Aim38/Rcf2 may act as bridges to support supercomplex assembly, particularly affecting the peripheral COX subunits Cox12 and Cox13.
Several promising research directions emerge from the current understanding of AIM31/Rcf1 function in fungal mitochondria:
Structural Biology Approaches:
Determination of the high-resolution structure of AIM31/Rcf1, ideally in complex with its interaction partners
Cryo-EM analysis of the entire respiratory supercomplex with and without AIM31
Regulatory Mechanisms:
Investigation of post-translational modifications that might regulate AIM31 function
Examination of how AIM31 expression and activity respond to different metabolic states
Evolutionary Analyses:
Comparative studies across fungal species to understand the evolution of AIM31/Rcf1 function
Examination of potential functional divergence between AIM31 and Aim38
Connection to Hypoxia Response:
Detailed investigation of the relationship between AIM31/Rcf1 (as a Hig1 family member) and cellular responses to hypoxia
Exploration of potential oxygen-sensing mechanisms involving AIM31
Functional Overlap with Other Supercomplex Components:
Systematic analysis of genetic interactions between AIM31 and other factors involved in respiratory complex assembly
Investigation of potential redundancy beyond the known overlap with Aim38/Rcf2
Application to Biotechnology:
These research directions would significantly advance our understanding of mitochondrial respiratory complex organization and function, potentially yielding insights applicable beyond fungal systems to broader eukaryotic biology.
Research on AIM31/Rcf1 in fungal systems has potential translational relevance for understanding human mitochondrial diseases through several mechanisms:
Conservation of Respiratory Complex Organization:
The Hig1 protein family, to which AIM31/Rcf1 belongs, is conserved across eukaryotes, suggesting functional significance in human mitochondria
Understanding the role of these proteins in supercomplex assembly could inform mechanisms of mitochondrial dysfunction in human disease
Insights into Cytochrome c Oxidase (COX) Deficiencies:
AIM31/Rcf1's close association with COX, particularly with Cox3, and its impact on peripheral subunits Cox12 and Cox13 , may provide insights into mechanisms underlying human COX deficiencies
These deficiencies represent a significant category of mitochondrial diseases with diverse clinical presentations
Understanding Supercomplex Dynamics:
Hypoxia Response Mechanisms:
As a member of the hypoxia-induced gene 1 family, AIM31/Rcf1 research may illuminate connections between respiratory function and cellular adaptation to low oxygen - a process relevant to ischemic diseases and cancer biology
Therapeutic Target Identification:
Identifying the precise mechanisms by which AIM31/Rcf1 influences respiratory complex assembly and function could reveal novel therapeutic targets for mitochondrial diseases
Modulation of supercomplex assembly represents a potential intervention strategy that has not been extensively explored
Research methodologies developed for studying AIM31/Rcf1 in fungal systems could be adapted to investigate human homologs, potentially accelerating progress in understanding mitochondrial disease mechanisms.
Advancing our understanding of AIM31/Rcf1 function would benefit significantly from integrative, interdisciplinary approaches that combine multiple scientific perspectives:
This multifaceted approach would provide a more comprehensive understanding of AIM31's role in mitochondrial function and potentially reveal unexpected connections to other cellular processes.
Researchers working with recombinant AIM31/Rcf1 may encounter several technical challenges during expression and purification. Based on the properties of AIM31 and similar mitochondrial membrane proteins, the following issues and solutions are recommended:
Protein Solubility Issues:
Challenge: As a mitochondrial protein that associates with membrane complexes, AIM31 likely contains hydrophobic regions that can cause aggregation during expression and purification.
Solution: Express the protein with solubility-enhancing fusion partners (e.g., MBP, SUMO) in addition to the His-tag. Use mild detergents like digitonin that have proven effective for maintaining supercomplex integrity . Consider step-wise detergent exchange during purification.
Maintaining Native Conformation:
Challenge: Ensuring the recombinant protein retains its native structure and function.
Solution: Include stabilizing agents such as trehalose (as mentioned in the buffer composition) . Validate protein folding using circular dichroism or limited proteolysis assays. Consider co-expression with interaction partners.
Low Expression Yields:
Challenge: Mitochondrial proteins often express poorly in heterologous systems.
Solution: Optimize codon usage for the expression host. Test multiple expression conditions (temperature, induction time, media composition). Consider specialized E. coli strains designed for membrane protein expression.
Protein Degradation:
Challenge: Proteolytic degradation during expression or purification.
Solution: Include protease inhibitors throughout the purification process. Perform purification at 4°C when possible. Consider using E. coli strains deficient in specific proteases.
Functional Validation:
Challenge: Confirming that the purified protein retains its ability to interact with respiratory complexes.
Solution: Develop in vitro binding assays using isolated mitochondrial complexes. Consider reconstitution experiments in liposomes or nanodiscs to better mimic the membrane environment.
Implementing these strategies should help researchers overcome common technical challenges associated with recombinant AIM31 production and ensure that the purified protein is suitable for downstream functional and structural studies.
When faced with contradictory results in AIM31/Rcf1 functional studies, researchers should implement a systematic troubleshooting approach:
Genetic Background Verification:
Issue: Undetected suppressor mutations or genetic drift in laboratory strains can confound results.
Resolution: Sequence-verify all strains, particularly in regions affecting mitochondrial function. Consider recreating knockout strains from validated wild-type backgrounds. Remember that the functional redundancy between AIM31 and Aim38 means single knockouts may show minimal phenotypes .
Growth Condition Standardization:
Issue: Variations in media composition, carbon source, or oxygen availability can dramatically affect mitochondrial phenotypes.
Resolution: Establish strictly controlled growth protocols across experiments. Consider using continuous culture systems (chemostats) to maintain consistent physiological states.
Assay Sensitivity and Specificity:
Issue: Different assay methods may have varying sensitivities for detecting changes in respiratory function.
Resolution: Use multiple independent assays to measure the same parameter. Calibrate assays using positive and negative controls with known degrees of respiratory dysfunction.
Protein Interaction Context:
Issue: Contradictory results regarding AIM31's interaction partners may stem from different solubilization conditions.
Resolution: Compare results obtained with different detergents, focusing on mild conditions (e.g., digitonin) that preserve supercomplex integrity . Perform interaction studies both in vivo and with purified components.
Developmental and Metabolic State:
Issue: The importance of AIM31 may vary with cellular metabolic state.
Resolution: Systematically test function across different growth phases and nutrient conditions. Consider inducible systems to examine acute versus chronic effects of AIM31 loss.
By implementing these methodological refinements, researchers can often resolve apparent contradictions and develop a more nuanced understanding of AIM31's context-dependent functions.
Optimizing detection of AIM31/Rcf1 in mitochondrial samples requires attention to several technical aspects specific to this protein and its localization. Based on the properties of AIM31 and similar mitochondrial proteins, the following optimization strategies are recommended:
Sample Preparation Considerations:
Use gentle isolation methods for mitochondria to preserve supercomplex integrity
Employ appropriate detergents for solubilization; digitonin has been successfully used to maintain association of AIM31 with respiratory complexes
Consider density gradient purification of mitochondria for highest purity when needed
Immunodetection Optimization:
Generate high-specificity antibodies against unique epitopes of AIM31
For western blotting, optimize transfer conditions for small proteins (AIM31 is approximately 18 kDa)
Use appropriate blocking agents to minimize background in mitochondrial samples
Include both positive controls (purified recombinant protein) and negative controls (ΔAIM31 mitochondria)
Tagged Protein Approaches:
Consider C-terminal tagging, as N-terminal modification may interfere with mitochondrial targeting
Verify that tags do not disrupt protein function through complementation assays
Use smaller epitope tags when possible to minimize functional interference
Blue Native PAGE Detection:
Mass Spectrometry Enhancement:
Implement targeted proteomics approaches (SRM/MRM) for highest sensitivity detection
Consider chemical crosslinking prior to isolation to preserve transient interactions
Optimize digestion conditions to generate detectable peptides from AIM31
By implementing these optimized detection methods, researchers can improve sensitivity and specificity in detecting AIM31/Rcf1 in mitochondrial samples, facilitating more robust experimental outcomes in functional studies.