Recombinant Chaetomium globosum Chitin synthase export chaperone (CHS7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that tag.
Synonyms
CHS7; CHGG_05314; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)
Target Names
CHS7
Target Protein Sequence
MGFGDFTGLCRMAPLPLCSSVGPITSIASGVGIEPDCYARNIEVANTIIFQGAASAMHII ALVMTVVMILHVRGKFTAVGRKEITTFFYLYMLLTFLSLCVDAGVVPPGSAPYPYFVAVQ AGLASATVTCLMINGFVGFQLYEDGTPLSLWMMRLCSAAAFVISFLVALATFKTWAGLGP TNTIGLFVVLYLLNAVQLFVYVVLQVLLVMRTLHDRWPLGDIAFGMFFFVAGQVILYAAS APICKAISHYLDGLFFATTCNLLAVMMVYKYWDSITKEDLEFSVGTRMNNWEVKDLLPEE DRRATVYHDDPYGQSTAYDNSYSPSPNRHSRY
Uniprot No.

Target Background

Function
This chaperone is required for the export of chitin synthase CHS3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Chaetomium globosum and why is its Chitin synthase export chaperone significant?

Chaetomium globosum is a saprophytic ascomycete fungus with worldwide distribution, commonly found in soil, plant debris, and water-damaged building materials. It is a thermotolerant fungus characterized by grayish-brown, woolly colonies with coiled setae and brown, subglobose ascospores . The fungus produces several mycotoxins, including chaetoglobosins and chaetoviridins, which have been detected in building materials in high quantities (950 and 200 mg m⁻² respectively) .

The Chitin synthase export chaperone (CHS7) is a protein encoded by the CHS7 gene (ORF name: CHGG_05314) in C. globosum . This protein is significant because:

  • It plays a crucial role in the biosynthesis and export of chitin, a key component of fungal cell walls

  • Understanding CHS7 can provide insights into fungal cell wall formation, integrity, and potential antifungal targets

  • It represents a model for studying protein trafficking and secretion in filamentous fungi

  • Its study may help understand C. globosum's adaptation to different environments, including indoor spaces where it can cause health concerns

How does CHS7 function in Chaetomium globosum?

CHS7 functions as a chaperone protein that facilitates the proper folding, processing, and export of chitin synthase enzymes from the endoplasmic reticulum to the Golgi apparatus and eventually to the plasma membrane. The specific functional mechanisms include:

  • Recognition and binding of newly synthesized chitin synthase enzymes in the endoplasmic reticulum

  • Prevention of premature aggregation or misfolding of chitin synthase proteins

  • Facilitation of proper membrane insertion and trafficking

  • Potential regulation of chitin synthase activity in response to environmental or developmental cues

The 332-amino acid sequence of C. globosum CHS7 (UniProt Q2H7Q1) contains transmembrane domains and conserved regions that are consistent with its role in membrane protein chaperoning and trafficking . This function is critical for maintaining cell wall integrity, which is essential for fungal survival and pathogenicity.

What is the genomic context of the CHS7 gene in Chaetomium globosum?

The CHS7 gene (ORF name: CHGG_05314) is part of the C. globosum genome, which was sequenced through the Broad Institute's Fungal Genome Initiative. The genome sequence of C. globosum strain CBS 148.51 was completed with 7X coverage and released in December 2004, with automated annotation released in June 2005 .

The genomic context of CHS7 includes:

  • Its location within the genome assembly

  • Potential regulatory elements in the promoter region

  • Conservation patterns across related fungal species

  • Association with other genes involved in cell wall synthesis and maintenance

The complete genome sequence of C. globosum has facilitated comprehensive studies of its genes, including CHS7, providing a foundation for understanding the genetic basis of this fungus's biology, including its cell wall synthesis machinery and potential virulence factors.

How can recombinant CHS7 be optimally expressed and purified for structural studies?

The optimal expression and purification of recombinant CHS7 for structural studies requires careful consideration of several factors:

Expression System Selection:

  • E. coli systems may be suitable for expressing soluble domains but challenging for the full-length protein due to its transmembrane regions.

  • Yeast expression systems (S. cerevisiae or P. pastoris) offer advantages for eukaryotic membrane proteins.

  • Insect cell or mammalian cell systems provide more complex post-translational modifications but at higher cost.

Methodological Approach:

  • Clone the CHS7 coding sequence into an appropriate expression vector with a fusion tag (His, GST, or MBP) to aid purification.

  • For E. coli expression, use strains specialized for membrane proteins (e.g., C41/C43) and lower induction temperatures (16-20°C).

  • For difficult-to-express regions, consider domain-based approaches focusing on soluble portions.

Purification Protocol:

  • Solubilize membrane-bound CHS7 using detergents (DDM, LDAO, or LMNG).

  • Employ multi-step purification including affinity chromatography, ion exchange, and size exclusion.

  • Assess protein quality using SDS-PAGE, Western blotting, and mass spectrometry.

  • Verify protein folding using circular dichroism spectroscopy.

Structural Analysis Preparation:

  • Screen buffer conditions for stability using differential scanning fluorimetry.

  • Consider amphipols or nanodiscs for stabilizing the protein for cryo-EM studies.

  • For crystallography, implement surface entropy reduction or use antibody fragments to promote crystal formation.

The successful expression and purification of CHS7 would facilitate structural studies that could reveal critical insights into its chaperone mechanism and potential as a target for antifungal development.

What are the key experimental approaches for studying CHS7 function in vivo?

Investigating CHS7 function in vivo requires multiple complementary approaches:

Genetic Manipulation Strategies:

  • Gene deletion/knockout using CRISPR-Cas9 or homologous recombination methods

  • RNA interference (RNAi) for targeted gene silencing

  • Gene overexpression studies

  • Site-directed mutagenesis to identify critical functional residues

For C. globosum specifically, PEG4000-mediated plastid transformation has been demonstrated as an effective method for genetic manipulation, with transformants selected based on hygromycin resistance (200 μg/ml) .

Phenotypic Analysis Methods:

  • Cell wall integrity assays using compounds like Calcofluor White and Congo Red

  • Chitin content quantification using fluorescent wheat germ agglutinin (WGA) staining

  • Growth rate and morphology assessments under various stress conditions

  • Transmission electron microscopy to visualize cell wall ultrastructure

Protein Localization and Interaction Studies:

  • Fluorescent protein tagging (GFP, mCherry) for subcellular localization

  • Immunofluorescence microscopy with specific antibodies

  • Co-immunoprecipitation to identify interaction partners

  • Proximity labeling approaches (BioID, APEX) to map the CHS7 interactome

Functional Complementation:

  • Cross-species complementation assays with CHS7 homologs

  • Domain swapping experiments to identify functional regions

  • Rescue experiments with wild-type CHS7 in knockout strains

The integration of these approaches would provide comprehensive insights into CHS7 function, its relationship with chitin synthases, and its broader role in cell wall biogenesis in C. globosum.

What are the most effective methods for transformation and genetic manipulation of Chaetomium globosum to study CHS7?

Based on successful approaches with C. globosum, the following methodological framework is recommended for genetic manipulation to study CHS7:

Protoplast Preparation and Transformation:

  • Culture C. globosum W7 or related strains at 28°C on PDA medium (potato 200g, dextrose 20g, agar 15g per 1000ml water)

  • Harvest young mycelia and digest cell walls using lysing enzymes (e.g., Lysing Enzymes from Trichoderma harzianum or Glucanex)

  • Employ PEG4000-mediated transformation using protocols described by Anthony et al. (1994) and Liu et al. (2019)

  • Select transformants on hygromycin (200 μg/ml) containing media

Genetic Modification Strategies:

  • Gene Silencing: Construct plasmids similar to CgMfs1-pSL2 containing CHS7 fragments for RNAi

  • Gene Overexpression: Create constructs like pBARGPE-CHS7-OE by amplifying the CHS7 CDS using PCR and cloning into an appropriate expression vector

  • CRISPR-Cas9 Editing: Design sgRNAs targeting CHS7 and clone into a Cas9-expressing vector

Verification Methods:

  • PCR confirmation of transformation events

  • Quantitative RT-PCR to verify expression changes using reference genes like β-actin (CH408033.1)

  • Western blotting to confirm protein level changes

  • Phenotypic characterization focusing on cell wall integrity

Culture Conditions for Phenotypic Assessment:

  • Standard growth on PDA at 28°C for morphological comparisons

  • Specialized media containing cell wall-perturbing agents (Calcofluor White, Congo Red)

  • Stress conditions (temperature shifts, pH variations, osmotic stress)

This methodological approach has proven effective for manipulating other genes in C. globosum and can be readily adapted for CHS7 studies, allowing for comprehensive functional characterization of this important cell wall-related protein.

How can researchers effectively analyze the interaction between CHS7 and chitin synthases?

Analyzing the interaction between CHS7 and chitin synthases requires a multi-faceted approach combining biochemical, genetic, and imaging techniques:

In Vitro Interaction Analysis:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged versions of CHS7 and chitin synthases

    • Lyse cells in detergent-containing buffers that preserve protein-protein interactions

    • Precipitate complexes using antibodies against the tags

    • Analyze co-precipitated proteins by Western blotting or mass spectrometry

  • Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI):

    • Purify recombinant CHS7 and chitin synthase domains

    • Immobilize one protein on a sensor chip

    • Measure binding kinetics and affinity constants

    • Determine the effects of mutations on binding efficiency

In Vivo Interaction Studies:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse CHS7 and chitin synthases to complementary fragments of a fluorescent protein

    • Transform C. globosum with these constructs

    • Observe fluorescence restoration upon protein interaction

    • Map interaction domains through truncation constructs

  • Förster Resonance Energy Transfer (FRET):

    • Tag CHS7 and chitin synthases with donor and acceptor fluorophores

    • Measure energy transfer as an indicator of protein proximity

    • Perform acceptor photobleaching to confirm specific interactions

Genetic Interaction Analysis:

  • Create single and double mutants of CHS7 and various chitin synthase genes

  • Perform epistasis analysis to determine genetic relationships

  • Assess synthetic lethality or enhancement of phenotypes

Localization Studies:

  • Use fluorescently tagged proteins to track co-localization

  • Employ super-resolution microscopy for detailed spatial analysis

  • Perform time-lapse imaging to capture dynamic interactions during cell wall synthesis

By integrating these approaches, researchers can build a comprehensive model of how CHS7 interacts with chitin synthases to facilitate their proper folding, transport, and function in the cell wall biosynthesis pathway.

What analytical techniques are most effective for characterizing the structural properties of recombinant CHS7?

Characterizing the structural properties of recombinant CHS7 requires a combination of biophysical and biochemical techniques suited for membrane-associated proteins:

Primary Structure Analysis:

  • Mass Spectrometry:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for sequence verification

    • Top-down proteomics for intact protein analysis

    • Mass fingerprinting to confirm expression of the complete 332-amino acid sequence

  • Post-translational Modification Mapping:

    • Phosphoproteomics to identify regulatory sites

    • Glycosylation analysis using specialized MS approaches

    • Chemical crosslinking followed by MS to identify structural constraints

Secondary and Tertiary Structure Analysis:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV CD (190-250 nm) to estimate secondary structure content

    • Near-UV CD (250-350 nm) to probe tertiary structure

    • Thermal denaturation studies to assess stability

  • Fourier-Transform Infrared Spectroscopy (FT-IR):

    • Analysis of amide bands to determine secondary structure elements

    • Particularly useful for membrane proteins in lipid environments

Membrane Topology Studies:

  • Protease Protection Assays:

    • Limited proteolysis of membrane-embedded CHS7

    • MS identification of protected fragments

    • Mapping of membrane-spanning regions

  • Substituted Cysteine Accessibility Method (SCAM):

    • Introduction of cysteine residues at various positions

    • Selective labeling of accessible cysteines

    • Determination of membrane topology

High-Resolution Structural Analysis:

  • X-ray Crystallography:

    • Challenging for full-length membrane proteins

    • May be feasible for soluble domains

    • Requires high-purity, homogeneous samples

  • Cryo-Electron Microscopy:

    • Single-particle analysis for medium to high-resolution structures

    • Suitable for membrane proteins in detergent micelles or nanodiscs

    • Does not require crystallization

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solution NMR for smaller domains

    • Solid-state NMR for membrane-embedded regions

    • Provides dynamic information not available from static techniques

By combining these analytical approaches, researchers can build a comprehensive structural model of CHS7, gaining insights into its chaperone function and interaction with chitin synthases.

How does CHS7 from Chaetomium globosum compare to homologous proteins in other fungal species?

A comparative analysis of CHS7 across fungal species reveals important evolutionary patterns and functional conservation:

Sequence Conservation Analysis:

The 332-amino acid CHS7 protein from C. globosum shows varying degrees of conservation with homologs in other fungi. Key similarities and differences include:

  • Core Domains: Highest conservation in transmembrane domains and functional motifs involved in chitin synthase recognition

  • Variable Regions: Greater divergence in species-specific regulatory regions

  • Phylogenetic Distribution: Closer relationship to homologs in other Ascomycetes compared to Basidiomycetes

Comparative Functional Studies:

Fungal SpeciesCHS7 HomologSequence Identity (%)Key Functional DifferencesCell Wall Characteristics
Saccharomyces cerevisiaeScChs7p~35-40Well-characterized role in ER export of Chs3pThinner cell wall, lower chitin content
Aspergillus fumigatusAfChs7~45-50Associated with higher chitin contentThicker cell wall, pathogenicity-related
Neurospora crassaNcChs7~55-60Involved in hyphal developmentRapid hyphal extension
Candida albicansCaChs7p~40-45Role in virulence and host interactionDynamic cell wall during morphogenesis
Chaetomium globosumCgCHS7100 (reference)Potentially linked to stress responseAssociated with mycotoxin production

Structural Conservation:

  • Predicted membrane topology shows consistent pattern of transmembrane domains across species

  • Conserved ER retention signals and sorting motifs

  • Species-specific variations in cytoplasmic loops potentially related to regulatory interactions

Functional Complementation:
Cross-species complementation studies (where available) indicate that:

  • CHS7 homologs can partially rescue phenotypes in heterologous systems

  • Species-specific functions exist that cannot be complemented

  • The degree of functional conservation correlates with taxonomic proximity

This comparative analysis provides valuable context for understanding the evolution of chitin synthase export machinery across fungi and highlights both conserved mechanisms and species-specific adaptations in C. globosum.

How does Chaetomium globosum CHS7 contribute to the fungus's adaptation to different environments?

CHS7's role in C. globosum's environmental adaptation appears to be multifaceted, particularly considering the fungus's prevalence in water-damaged buildings and its production of mycotoxins:

Adaptation to Building Materials:

C. globosum is commonly found in wet cellulosic building materials worldwide . CHS7 likely contributes to this adaptation through:

  • Facilitating cell wall modifications that enable adherence to and colonization of building materials

  • Supporting growth on cellulose-rich substrates through proper chitin synthase trafficking

  • Enabling the cell wall remodeling necessary for penetration of substrate materials

  • Maintaining cell wall integrity under the osmotic and pH stresses encountered in building environments

Response to Environmental Stressors:

The protein likely plays a key role in stress adaptation through:

  • Temperature Stress: C. globosum is thermotolerant , and CHS7-mediated cell wall modifications may contribute to temperature resistance

  • Desiccation Resistance: Proper cell wall structure is crucial for surviving periodic drying in building environments

  • Osmotic Stress: Cell wall integrity is essential for managing osmotic challenges

  • Competition: Cell wall properties affect interactions with other microorganisms in the same niche

Connection to Mycotoxin Production:

C. globosum produces several mycotoxins in building materials in substantial quantities:

  • Chaetoglobosins (950 mg m⁻²)

  • Chaetoviridins/chaetomugilins (200 mg m⁻²)

These mycotoxins have inflammatory effects, as demonstrated in mouse alveolar macrophage studies . The relationship between CHS7, cell wall integrity, and mycotoxin production may involve:

  • Cell wall stress triggering secondary metabolite production as a defense mechanism

  • CHS7-dependent export machinery potentially involved in mycotoxin secretion

  • Shared regulatory pathways coordinating cell wall maintenance and secondary metabolism

Research Approach to Investigate This Role:

To understand CHS7's contribution to environmental adaptation:

  • Compare CHS7 expression levels across different growth substrates and stress conditions

  • Assess colonization efficiency of CHS7 mutants on various building materials

  • Measure mycotoxin production in relation to CHS7 expression levels

  • Perform comparative genomics across Chaetomium species with different ecological niches

This research would provide valuable insights into how C. globosum has become successful in indoor environments and could inform strategies for controlling its growth and mycotoxin production in water-damaged buildings.

What are the potential applications of studying CHS7 for developing new antifungal strategies?

The study of CHS7 opens several promising avenues for novel antifungal development:

Targeting CHS7 as an Antifungal Strategy:

  • Rational Drug Design:

    • Develop small molecules that specifically inhibit CHS7 function

    • Target protein-protein interactions between CHS7 and chitin synthases

    • Design peptidomimetics that disrupt CHS7's chaperone activity

  • Advantage over Direct Chitin Synthase Inhibitors:

    • Potential for greater specificity due to sequence divergence from human proteins

    • Possible synergistic effects when combined with existing chitin synthase inhibitors

    • Novel mode of action that could address resistance to current antifungals

Research Methodologies for Antifungal Discovery:

  • High-Throughput Screening:

    • Develop cell-based assays measuring CHS7-dependent chitin synthase export

    • Screen chemical libraries for compounds disrupting CHS7 function

    • Use fluorescent protein fusions to visualize trafficking disruption

  • Structure-Based Approaches:

    • Use structural information from CHS7 to identify binding pockets

    • Perform in silico docking studies to identify potential inhibitors

    • Rational modification of lead compounds based on structure-activity relationships

Potential Applications:

  • Building Remediation:

    • Targeted solutions for controlling C. globosum in water-damaged buildings

    • Reduction of mycotoxin production in indoor environments

    • Prevention of fungal colonization of building materials

  • Biomedical Applications:

    • Although C. globosum infections are rare, insights gained could apply to more common fungal pathogens

    • Strategies developed might translate to related Chaetomiaceae involved in opportunistic infections

  • Agricultural Uses:

    • Control of related plant pathogenic fungi

    • Reduction of mycotoxin contamination in crops

The development of CHS7-targeting antifungals would represent a novel approach that could complement existing strategies and potentially address issues of toxicity and resistance in current antifungal therapeutics.

What emerging technologies could advance our understanding of CHS7 structure and function?

Several cutting-edge technologies show promise for advancing CHS7 research:

Advanced Structural Biology Approaches:

  • Cryo-Electron Tomography:

    • Visualize CHS7 and chitin synthases in their native cellular context

    • Observe spatial relationships at near-atomic resolution

    • Track conformational changes during the chaperoning process

  • Single-Particle Cryo-EM:

    • Achieve high-resolution structures without crystallization

    • Capture multiple functional states of the protein

    • Particularly valuable for membrane-associated proteins like CHS7

  • Integrative Structural Biology:

    • Combine multiple experimental techniques (X-ray, NMR, EM, crosslinking-MS)

    • Generate comprehensive structural models incorporating dynamic information

    • Account for membrane environment effects on protein structure

Advanced Genetic and Genomic Technologies:

  • CRISPR-Cas Systems for Fungi:

    • More efficient gene editing in C. globosum

    • Precise modifications at the nucleotide level

    • Multiplexed gene targeting for pathway analysis

  • Base Editors and Prime Editors:

    • Introduction of specific mutations without double-strand breaks

    • Assessment of structure-function relationships through targeted amino acid changes

    • Generation of conditional alleles for temporal control

Cutting-Edge Imaging Technologies:

  • Super-Resolution Microscopy:

    • Techniques like PALM, STORM, and STED for nanoscale visualization

    • Track individual CHS7 molecules during trafficking

    • Observe co-localization with interaction partners at unprecedented resolution

  • Correlative Light and Electron Microscopy (CLEM):

    • Connect functional data from fluorescence imaging with ultrastructural details

    • Locate rare events in cellular context

    • Visualize CHS7 trafficking in relation to cellular compartments

Emerging Computational Approaches:

  • AlphaFold2 and Similar AI Systems:

    • Predict structural features with increasing accuracy

    • Model protein-protein interactions between CHS7 and chitin synthases

    • Guide experimental approaches through in silico predictions

  • Molecular Dynamics Simulations:

    • Model CHS7 behavior in membrane environments

    • Simulate interaction dynamics with chitin synthases

    • Predict effects of mutations or small molecule binding

These emerging technologies, particularly when used in combination, have the potential to dramatically advance our understanding of CHS7 structure and function, providing new insights that could lead to both fundamental discoveries and practical applications.

How might the study of CHS7 contribute to our broader understanding of fungal cell wall biosynthesis?

The study of CHS7 in C. globosum has significant potential to enhance our understanding of fungal cell wall biosynthesis in several key areas:

Integrating Cell Wall Component Synthesis:

Fungal cell walls are complex structures comprising chitin, glucans, and glycoproteins. CHS7 research could reveal:

  • How chitin synthesis is coordinated with other cell wall components

  • Regulatory mechanisms that balance different cell wall polymers

  • Trafficking pathways shared between different cell wall biosynthetic enzymes

  • Integration of cell wall synthesis with cellular growth and morphogenesis

Evolutionary Perspectives:

Comparative studies of CHS7 across fungal species can provide insights into:

  • The evolution of cell wall composition across fungal lineages

  • Adaptation of cell wall biosynthesis to different ecological niches

  • Conservation and divergence of trafficking mechanisms for cell wall-synthesizing enzymes

  • How fundamental cell wall biosynthesis processes have been modified for specialized functions

Connection to Fungal Lifestyle:

C. globosum's adaptation to indoor environments and its production of mycotoxins may reveal:

  • How cell wall biosynthesis responds to environmental conditions

  • The relationship between cell wall integrity and secondary metabolism

  • Mechanisms by which fungi sense and respond to substrate characteristics

  • Role of the cell wall in stress resistance and environmental adaptation

Methodological Advancements:

Research on CHS7 could drive new approaches for studying fungal cell walls:

  • Development of new fluorescent probes for tracking cell wall synthesis in real-time

  • Creation of genetic tools applicable to other difficult-to-study fungi

  • Establishment of quantitative assays for measuring cell wall component synthesis

  • Advanced imaging techniques for visualizing cell wall formation

Translational Applications:

Insights from CHS7 studies could inform:

  • Design of broad-spectrum antifungals targeting conserved aspects of cell wall biosynthesis

  • Development of species-specific approaches based on unique aspects of cell wall architecture

  • Strategies for controlling fungal growth in built environments

  • Methods for modulating fungal cell walls for biotechnological applications

By positioning CHS7 research within this broader context, investigators can ensure that their findings contribute to the larger framework of fungal biology while addressing specific questions about C. globosum's unique biology and ecological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.