Recombinant Chaetomium globosum Plasma membrane fusion protein PRM1 (PRM1)

Shipped with Ice Packs
In Stock

Description

Functional Role of PRM1 in Membrane Fusion

PRM1 is a conserved multipass transmembrane protein critical for plasma membrane fusion during cellular processes such as mating. In Saccharomyces cerevisiae, PRM1 ensures fidelity during bilayer fusion, preventing lysis by stabilizing membrane contact zones . Key findings include:

  • Mechanism: PRM1 localizes to fusion zones, enabling efficient membrane merger. Deletion leads to arrested mating pairs (40%) or lysis (20%) due to defective fusion machinery .

  • Calcium Dependency: In prm1Δ mutants, extracellular Ca²⁺ mitigates lysis, suggesting Ca²⁺-dependent repair mechanisms engage when fusion fails .

This mechanistic framework likely extends to fungal homologs, including Chaetomium globosum.

Recombinant PRM1 Production and Characterization

While C. globosum PRM1 has not been directly expressed, recombinant PRM1 protocols from other species provide actionable methodologies:

Table 1: Recombinant PRM1 Expression Systems

SpeciesExpression HostTagPurityApplicationSource
Coccidioides immitisE. coliHis-tag>90%Structural studies
HumanMammalian cellsRFP/His>80%Chromatin remodeling
West Nile VirusE. coliMBP fusionSolubleAntibody development

Key Steps for Recombinant PRM1 Production:

  • Cloning: Fusion with tags (e.g., His, MBP) for solubility and purification .

  • Expression: Induced via IPTG in E. coli or transfected into mammalian systems .

  • Purification: Affinity chromatography (e.g., amylose resin for MBP fusions) .

Transcriptional Regulation in Chaetomium globosum

Though not directly linked to PRM1, C. globosum gene regulation studies highlight potential pathways:

  • CgXpp1: A bHLH-type transcriptional regulator that indirectly enhances chaetoglobosin A (CheA) biosynthesis by derepressing biosynthetic genes .

  • Implications: PRM1 expression in C. globosum could similarly involve regulatory factors like CgXpp1, given its role in secondary metabolite production .

Table 2: Epitope Peptides of Viral PRM1

PeptideSequence (N→C terminus)
prM-11VTLSNFQGKVMMTVNA16
prM-533LCIVRAMDVGYMCDDT48
prM-1073AVYVRYGRCTKTRHSR88

Such epitopes aid in antibody development, as seen with MAb 10F7, which recognizes native prM protein .

Potential Applications in Biotechnology

  • Fertility Markers: PRM1’s role in sperm DNA compaction (e.g., bull fertility ) suggests utility in fungal reproductive studies.

  • Chromatin Engineering: Human PRM1 remodels chromatin by displacing histones (e.g., H3K9me3) , a mechanism exploitable for fungal epigenetic editing.

Research Gaps and Future Directions

  • Homolog Identification: Genome mining of C. globosum could reveal PRM1 homologs using conserved domains (e.g., transmembrane regions).

  • Functional Assays: Fluorescent tagging (e.g., RFP ) and mating/fusion assays would validate PRM1’s role.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
PRM1; CHGG_10686; Plasma membrane fusion protein PRM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-722
Protein Length
full length protein
Species
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)
Target Names
PRM1
Target Protein Sequence
MFYNEKTGAVPPVPSNLNANTWHTVDLQPAPQLQPHAHTAPTVTPYLGLRARLSQLWFNR WTILLILVLVRVLILTAGLNDNIGDAKTKALSACTKVEDIGSAMASMPHYLSVGVNSMAA DGITKTVSGMVKMLMMILTGVENLILFIINMYVGTYACLIAALIHGGLDVSVKVVEGATK VMNDAIGTITGQITESISDVQDAINKIPDTISSFLGGVDFDLPKIDITKNLDDLENIKIN SNELVRDIVALNKTIPTFDQVENFTKNAIAIPFNFLKEQVNSSFGSYKFDDSVFPVAEKQ ALSFCSNNSFLNDFFETLFNVVRTAKIAFCVAIPILAVLAIVGMGYLEIQRWRREKQRSR EFTERGYDPMDVVYLSSRPVTGGFGLWLSAKFKSVKKQLLVRWTIAYGTSLPALFVLSLA FAGLFSCLCQFIILRSIQKEAPALANQVGDFAGDVVGTLQQVSTNWADDANGVIIKLQDD INDDMFGWVSNATTAVNDTLNTFDDEIDKAITAVFKDTILFNTARNLVGCLITRKIETVQ EGLTWVHDNAHVTLPLFANDVFSQGANNSVNGDSDLTSFLASPSSVTTDEITSAVNQVIT KLEHGIVQEALISTALLLVYVIVVLSGAVRALVASAQKEKTRGEGGEQYGVKAPGSRGSS SASSGNSDNHHYHHHHDNSAPSDFDRKGVIYAGSVKRGRPGPERWPSHARKSSYPEVEGP DH
Uniprot No.

Target Background

Function
PRM1 is involved in cell fusion during mating by stabilizing the plasma membrane fusion event.
Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Chaetomium globosum and why is it significant in biological research?

Chaetomium globosum is a filamentous, saprophytic fungus belonging to the family Chaetomiaceae (Phylum Ascomycota). This mesophilic organism, first established by Kunze in 1817, has gained international recognition for its remarkable adaptability to extreme environments . It produces distinctive lemon-shaped olive brown ascospores within globose to pyriform-shaped perithecia with irregularly coiled appendages .

The significance of C. globosum in research stems from its exceptional biocontrol potential against numerous plant pathogens, particularly Bipolaris sorokiniana. Its antagonistic mechanisms include:

  • Mycoparasitism

  • Production of antifungal metabolites (chaetoglobosins A and C, chaetomin, cochliodinol, etc.)

  • Competition for space and nutrients

  • Induction of systemic resistance in plants

At the microscopic level, C. globosum has been documented to cause deformation of pathogen conidia, wall distortion, lysis, and formation of holes in target pathogens, effectively inhibiting conidial germination and hyphal elongation .

How does recombinant expression of Chaetomium globosum PRM1 differ from native expression?

Recombinant expression of C. globosum PRM1 introduces several important differences compared to native expression:

  • Expression levels: Recombinant systems typically yield higher protein concentrations than naturally occurring in the organism, allowing for better detection and purification.

  • Post-translational modifications: Depending on the expression system used (bacterial, yeast, insect, or mammalian cells), the post-translational modifications may differ significantly from native C. globosum processing.

  • Functional implications: Recombinant PRM1 may demonstrate altered activity profiles compared to the native protein due to differences in folding, glycosylation patterns, and other modifications.

  • Experimental advantages: Recombinant expression allows for targeted mutations, domain deletions, and fusion tags that facilitate functional studies not possible with native protein.

A methodological consideration for researchers is the selection of an appropriate expression system that best preserves the key structural and functional characteristics of the native protein while enabling experimental manipulation.

What are the optimal expression systems for recombinant production of Chaetomium globosum PRM1?

The selection of an expression system for recombinant C. globosum PRM1 should be guided by research objectives and protein characteristics:

Expression SystemAdvantagesLimitationsBest For
E. coli- High yield
- Cost-effective
- Rapid production
- Established protocols
- Limited post-translational modifications
- Potential improper folding
- Inclusion body formation
- Initial protein characterization
- Structural studies of individual domains
- Antibody production
Yeast (P. pastoris, S. cerevisiae)- Eukaryotic processing
- Good secretion
- High density cultures
- Moderate cost
- Hyperglycosylation possible
- Longer production time
- Lower yields than bacteria
- Functional studies requiring proper folding
- Studies involving glycosylation
- Scaled-up production
Insect cells- Near-native eukaryotic processing
- Good for complex proteins
- High expression levels
- More expensive
- Technically demanding
- Longer development time
- Structural biology applications
- Interaction studies
- Proteins requiring complex folding
Mammalian cells- Most authentic post-translational modifications
- Proper folding
- Membrane protein expression
- Highest cost
- Lowest yields
- Most complex methodology
- Detailed functional studies
- Interaction studies with mammalian proteins
- Therapeutic applications

For C. globosum PRM1, which is a membrane fusion protein likely requiring proper folding and post-translational modifications, yeast or insect cell expression systems typically offer the best balance between authentic processing and reasonable yields for most research applications.

How should researchers design purification strategies for recombinant Chaetomium globosum PRM1?

Purification of recombinant C. globosum PRM1 presents specific challenges due to its membrane-associated nature. A methodological workflow should include:

  • Tag selection: Fusion tags such as His6, FLAG, or Strep-tag II enable affinity purification while minimizing interference with protein function. For structural studies, cleavable tags using TEV or PreScission protease sites are recommended.

  • Membrane extraction: Optimize detergent screening with a panel including:

    • Mild detergents (DDM, LMNG) for functional studies

    • Stronger detergents (SDS, Triton X-100) for maximum extraction efficiency

    • Novel amphipols or nanodiscs for structural biology applications

  • Purification protocol:

    • Initial IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

    • Secondary purification via ion exchange or size exclusion chromatography

    • Quality assessment via SDS-PAGE, Western blot, and activity assays

  • Buffer optimization:

    • Screen pH ranges (typically 6.5-8.0)

    • Test stabilizing additives (glycerol 5-10%, reducing agents)

    • Consider addition of lipids for membrane protein stability

For researchers targeting structural studies, detergent exchange to amphipols or reconstitution into nanodiscs may provide a more native-like environment for the membrane protein and enhance stability during crystallization or cryo-EM preparation.

What analytical methods are most effective for characterizing the structure-function relationship of recombinant PRM1?

Comprehensive characterization of recombinant C. globosum PRM1 requires a multi-technique approach:

Researchers should consider combining these approaches to build a comprehensive understanding of how specific structural features contribute to PRM1's membrane fusion function.

How does PRM1 interact with the polyketide synthesis machinery in Chaetomium globosum?

The interaction between PRM1 and polyketide synthesis (PKS) machinery in C. globosum represents an emerging area of research. While direct evidence for specific interactions is limited, several mechanistic hypotheses can be considered:

  • Membrane localization: PRM1 may facilitate the proper membrane localization of certain PKS complexes, particularly highly-reducing PKS (HR-PKS) systems that have been characterized in C. globosum .

  • Compartmentalization: By participating in membrane fusion events, PRM1 may contribute to the formation or maintenance of specialized compartments where polyketide biosynthesis occurs.

  • Transport functions: PRM1 might facilitate the transport of polyketide intermediates between biosynthetic compartments or the export of final products.

  • Regulatory roles: Membrane events mediated by PRM1 could influence the expression or activity of biosynthetic gene clusters like the characterized caz biosynthetic cluster .

Experimental approaches to investigate these potential interactions include co-immunoprecipitation studies, fluorescent co-localization experiments, and comparative transcriptomics between wild-type and PRM1-deficient strains.

What is known about the role of PRM1 in antagonistic interactions between Chaetomium globosum and plant pathogens?

The potential role of PRM1 in C. globosum's antagonistic mechanisms against plant pathogens can be understood within the broader context of the fungus's established biocontrol activities:

  • Mycoparasitism facilitation: PRM1-mediated membrane fusion events may be crucial during direct hyphal interactions with pathogens like B. sorokiniana, potentially enabling more efficient penetration of the host pathogen .

  • Secondary metabolite production: While C. globosum produces numerous antifungal compounds (chaetoglobosins, chaetomin, cochliodinol), the role of PRM1 in their biosynthesis or export remains an open research question .

  • Competitive fitness: PRM1 function might contribute to C. globosum's ability to compete for space and nutrients with pathogens, a known mechanism of its antagonistic activity .

To investigate these hypotheses, researchers can employ comparative studies between wild-type and PRM1-knockout strains, assessing differences in:

  • Antagonistic efficacy against pathogens

  • Production profiles of key secondary metabolites

  • Transcriptomic responses during pathogen interactions

  • Hyphal morphology and fusion events during mycoparasitism

How does PRM1 deficiency impact cellular processes in model organisms, and what insights might this provide for Chaetomium globosum research?

Studies on PRM1 deficiency in model organisms provide valuable comparative insights that can inform C. globosum research. In mouse models, PRM1 deficiency leads to:

  • Chromatin organization defects: Complete loss of PRM1 (Prm1-/-) results in severe DNA fragmentation, while heterozygous (Prm1+/-) mice show moderate DNA damage .

  • Increased oxidative stress: PRM1-deficient models display enhanced 8-OHdG levels, indicating elevated reactive oxygen species (ROS) .

  • Protein processing disruption: Loss of PRM1 affects the processing of related proteins (notably PRM2), suggesting regulatory interdependence .

  • Functional impairment: PRM1 deficiency results in reduced motility and membrane integrity defects in specialized cells .

These findings suggest potential avenues for C. globosum research:

  • Investigation of PRM1's role in protecting C. globosum DNA during environmental stress

  • Exploration of potential relationships between PRM1 and oxidative stress responses during antagonistic interactions

  • Examination of whether PRM1 regulates the processing or function of other membrane proteins

  • Assessment of how PRM1 contributes to membrane integrity during various life cycle stages

What CRISPR-Cas9 strategies are most effective for generating PRM1-deficient Chaetomium globosum strains?

Developing PRM1-deficient C. globosum strains requires careful CRISPR-Cas9 experimental design:

  • Guide RNA design considerations:

    • Target early exons to maximize disruption potential

    • Design multiple guide RNAs targeting different exons for comparison

    • Verify specificity through whole-genome analysis to minimize off-target effects

    • Consider targeting conserved functional domains based on sequence alignments with characterized PRM1 homologs

  • Delivery system optimization:

    • Polyethylene glycol (PEG)-mediated protoplast transformation

    • Agrobacterium-mediated transformation for fungi recalcitrant to direct delivery

    • Biolistic delivery for challenging strains

  • Verification methodologies:

    • PCR-based genotyping to confirm the presence of targeted deletions

    • Transcriptomic verification through RNA sequencing or RT-qPCR

    • Immunohistochemical confirmation of protein absence

    • Functional assays to demonstrate phenotypic effects

  • Phenotypic characterization:

    • Growth rate and morphology assessment

    • Stress response profiling

    • Antagonistic activity measurement against pathogens

    • Membrane fusion event quantification

Researchers working with C. globosum should be aware that transformation efficiency may vary significantly between strains, and optimization of protoplast generation and regeneration conditions is often necessary for successful genetic manipulation.

How can researchers distinguish between direct and indirect effects of PRM1 deficiency in functional studies?

Distinguishing direct from indirect effects of PRM1 deficiency requires sophisticated experimental approaches:

  • Complementation studies:

    • Reintroduce wild-type PRM1 to confirm phenotype rescue

    • Create domain-specific mutants to isolate functional regions

    • Use controlled expression systems to establish dose-dependency

  • Temporal control systems:

    • Inducible promoters to regulate PRM1 expression

    • Temperature-sensitive alleles to enable conditional function

    • Rapid protein degradation systems for acute protein removal

  • Spatial regulation approaches:

    • Tissue-specific or cell-type-specific promoters

    • Subcellular targeting sequences to restrict localization

    • Optogenetic tools for spatiotemporal control

  • Integrated multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use temporal sampling after PRM1 manipulation

    • Apply network analysis to distinguish primary from secondary effects

  • Direct interaction studies:

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

    • Cross-linking mass spectrometry for transient interactions

These approaches collectively allow researchers to build a time-resolved map of molecular changes following PRM1 perturbation, helping to differentiate immediate consequences from downstream effects.

What are the best approaches for studying the membrane fusion activity of recombinant PRM1 in vitro?

Studying membrane fusion activity of recombinant PRM1 requires specialized in vitro systems that recapitulate aspects of the natural membrane environment:

  • Liposome-based fusion assays:

    • Preparation of liposomes with fungal lipid compositions

    • Incorporation of fluorescent lipid probes (NBD-PE/Rh-PE pairs)

    • Measurement of lipid mixing via FRET or fluorescence dequenching

    • Content mixing assays using soluble fluorescent markers

  • Supported lipid bilayer systems:

    • Formation of planar bilayers on solid supports

    • Incorporation of recombinant PRM1

    • Visualization of membrane topological changes via atomic force microscopy

    • Real-time monitoring using total internal reflection fluorescence microscopy

  • Single-vesicle fusion assays:

    • Surface-tethered vesicles containing PRM1

    • High-resolution fluorescence microscopy to observe individual fusion events

    • Quantification of fusion kinetics and efficiency

  • Electrophysiological approaches:

    • Patch-clamp recordings of PRM1-reconstituted membranes

    • Black lipid membrane conductance measurements

    • Detection of fusion pore formation and expansion

  • Structural transition analysis:

    • Monitoring conformational changes during fusion using FRET sensors

    • Hydrogen-deuterium exchange mass spectrometry to track solvent accessibility

    • Time-resolved cryo-EM to capture fusion intermediates

These methodologies should be calibrated against well-characterized fusion systems (such as viral fusion proteins) to establish comparative benchmarks for interpreting PRM1 activity.

What are the most significant knowledge gaps in our understanding of Chaetomium globosum PRM1?

Current research on C. globosum PRM1 is limited by several key knowledge gaps:

  • Structural characterization: High-resolution structures of C. globosum PRM1 have not been determined, limiting our understanding of its mechanism of action and potential for targeted modifications.

  • Regulatory networks: The signaling pathways that regulate PRM1 expression and activation in C. globosum remain largely uncharacterized.

  • Interaction partners: A comprehensive interactome for PRM1 in C. globosum has not been established, leaving questions about its integration with other cellular systems.

  • Functional redundancy: The extent to which other proteins may compensate for PRM1 deficiency in C. globosum is unknown.

  • Evolutionary context: While PRM1 homologs have been studied in model organisms , the evolutionary trajectory and functional conservation of PRM1 across fungal lineages remain to be fully elucidated.

These knowledge gaps represent opportunities for groundbreaking research that could significantly advance our understanding of membrane fusion processes in filamentous fungi and potentially reveal novel applications in biocontrol technology.

How might transcriptome profiling approaches enhance our understanding of PRM1 function in Chaetomium globosum?

Transcriptome profiling represents a powerful approach for elucidating PRM1 function in C. globosum:

  • Differential expression analysis:

    • Compare wild-type and PRM1-deficient strains to identify compensatory responses

    • Analyze expression patterns during different developmental stages to determine temporal regulation

    • Examine transcriptional changes during antagonistic interactions with pathogens

  • Co-expression network analysis:

    • Identify genes with expression patterns correlated with PRM1

    • Construct functional modules that include PRM1 to predict biological roles

    • Compare networks across different conditions to detect context-dependent interactions

  • Integration with chromatin accessibility data:

    • Combine RNA-seq with ATAC-seq to identify regulatory elements controlling PRM1 expression

    • Map transcription factor binding sites in PRM1 promoter regions

    • Characterize epigenetic regulation of PRM1 and related genes

  • Alternative splicing analysis:

    • Identify potential PRM1 isoforms with distinct functions

    • Examine splicing regulation under different environmental conditions

    • Compare splicing patterns across fungal species

  • Single-cell transcriptomics:

    • Resolve cell-to-cell variability in PRM1 expression

    • Identify specialized cell populations with high PRM1 activity

    • Track transcriptional trajectories during developmental processes

Previous transcriptome profiling in C. globosum has successfully identified genes involved in biocontrol mechanisms , suggesting this approach would be similarly valuable for understanding PRM1 function.

What potential biotechnological applications might emerge from research on recombinant Chaetomium globosum PRM1?

Research on recombinant C. globosum PRM1 could lead to several innovative biotechnological applications:

  • Enhanced biocontrol agents:

    • Engineering strains with optimized PRM1 expression to improve antagonistic efficiency against plant pathogens

    • Developing PRM1-based formulations with extended field stability

    • Creating hybrid systems combining PRM1 with other biocontrol proteins

  • Novel membrane fusion technologies:

    • Designing PRM1-derived peptides for targeted liposome fusion in drug delivery

    • Creating biosensors based on PRM1 conformational changes

    • Developing cell-cell fusion systems for biotechnological applications

  • Structural biology platforms:

    • Using PRM1 as a model system for studying membrane protein dynamics

    • Developing new methodologies for membrane protein crystallization

    • Creating fungal-specific membrane protein expression systems

  • Agricultural innovations:

    • Engineering crop plants to express PRM1-derived peptides for enhanced disease resistance

    • Developing PRM1-based screening systems for novel antifungal compounds

    • Creating diagnostic tools for monitoring biocontrol agent efficacy

  • Fundamental research tools:

    • Establishing PRM1-based membrane fusion assays for studying cellular processes

    • Developing PRM1 variants as molecular tools for membrane manipulation

    • Creating optogenetic systems based on PRM1 domains for controlled membrane fusion

These potential applications highlight the importance of fundamental research on fungal membrane proteins like PRM1, as they may yield unexpected biotechnological innovations beyond their primary biological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.