Recombinant Chalinolobus tuberculatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Expression System & Production
This recombinant protein is produced in Escherichia coli and fused with a His tag for purification . Key specifications include:

ParameterDetail
SpeciesChalinolobus tuberculatus (New Zealand long-tailed bat)
UniProt IDQ9G3R5
Amino Acid Range1–98 residues (full-length)
Molecular Weight~11 kDa
Purity>90% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C

Functional Role in Complex I

Recombinant MT-ND4L contributes to NADH dehydrogenase (Complex I) activity by facilitating:

  1. Electron Transfer: From NADH to ubiquinone via FMN and Fe-S clusters .

  2. Proton Translocation: Generates a transmembrane proton gradient (4 H⁺/NADH oxidized) .

  3. Structural Stability: Forms part of the hydrophobic core essential for Complex I assembly .

Deficiency Impact:

  • Loss of ND4L disrupts Complex I assembly, reducing ATP synthesis by ~40% .

  • Linked to metabolic disorders (e.g., obesity) and Leber’s hereditary optic neuropathy (LHON) .

Clinical & Research Applications

Disease Associations
A T10663C (Val65Ala) mutation in MT-ND4L causes LHON by impairing electron transport, leading to retinal ganglion cell degeneration .

Experimental Uses

  • Biochemical Assays: Study proton-pumping mechanisms using reconstituted liposomes .

  • Drug Screening: Test inhibitors targeting NADH-ubiquinone binding sites (e.g., rotenone analogs) .

  • Structural Biology: Cryo-EM studies to resolve conformational changes during catalysis .

Comparative Analysis with Orthologs

SpeciesResiduesKey DifferencesReference
Homo sapiens98Val65Ala mutation linked to LHON
Pontoporia blainvillei9887% sequence identity; distinct C-terminal
Escherichia coli14 subunitsLacks ND4L homolog; uses NuoH instead

Technical Notes for Handling

  • Reconstitution: Lyophilized protein requires sterile water (0.1–1.0 mg/mL) with 50% glycerol for stability .

  • Avoid Repeated Thawing: Aliquot working doses to preserve activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Chalinolobus tuberculatus (New Zealand long-tailed bat)
Target Names
Target Protein Sequence
MSLTYLNIMLAFSTSLLGLLMYRSHLMSSLLCLEGLVLSLFVLTTLMVLTINLTLTNLLP IILLVFAACEAALGLSLLVVVSNTYGVDYVQNLNLLKC
Uniprot No.

Target Background

Function

This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its functional role in mitochondria?

The MT-ND4L gene provides instructions for making NADH dehydrogenase 4L protein, which functions as a component of Complex I in the mitochondrial respiratory chain. This protein is integral to the process of oxidative phosphorylation, which generates adenosine triphosphate (ATP), the cell's primary energy source. Within this system, MT-ND4L contributes to the first step of electron transport, facilitating the transfer of electrons from NADH to ubiquinone .

The protein operates within the inner mitochondrial membrane where it helps create the electrochemical gradient necessary for ATP synthesis. Recent studies indicate that the ND4L subunit specifically contributes to the proton translocation pathway within Complex I . This function is critical for maintaining proper mitochondrial function across various cell types.

What are the structural characteristics of the MT-ND4L gene and protein?

In the mitochondrial genome, the MT-ND4L gene typically spans positions 9880-10,173, comprising 294 base pairs. The gene utilizes ATG as its start codon and TAA as its stop codon, and is transcribed from the positive strand . The protein product forms a small but integral membrane-embedded component of Complex I.

The MT-ND4L protein contains several transmembrane helices that anchor it within the inner mitochondrial membrane. Structural analyses indicate that MT-ND4L forms critical interfaces with other subunits, particularly ND6, creating a region involved in proton translocation. This interface contains conserved residues such as Glu34 in ND4L that interact with residues like Tyr157 in ND6, forming hydrogen bonds that appear to be essential for the proton translocation mechanism .

How is MT-ND4L conserved across species, particularly within Chiroptera?

While the search results don't provide specific information about sequence conservation within Chiroptera (bats), the fundamental structural and functional characteristics of MT-ND4L are generally conserved across many species due to its essential role in energy metabolism.

Research comparing mitochondrial genomes across bat species has been conducted, as evidenced by studies on Glischropus bucephalus . For researchers interested in Chalinolobus tuberculatus specifically, comparative analysis of MT-ND4L sequences with other bat species could provide valuable insights into evolutionary relationships and functional conservation of this protein within Chiroptera.

What expression systems are most effective for producing recombinant MT-ND4L?

While the search results don't provide specific protocols for Chalinolobus tuberculatus MT-ND4L expression, researchers typically employ several approaches for mitochondrial membrane proteins:

For recombinant expression of mitochondrial proteins like MT-ND4L, bacterial systems such as Escherichia coli may be used with appropriate modifications to overcome challenges associated with membrane protein expression. These modifications often include using specialized strains, fusion tags for improved solubility, and controlled induction conditions.

Yeast expression systems, particularly Saccharomyces cerevisiae, offer advantages for mitochondrial proteins as they possess eukaryotic post-translational modification machinery. As noted in research on NDH-2-type alternative NADH-quinone oxidoreductases from S. cerevisiae, these systems can be valuable for detailed biochemical characterization of mitochondrial proteins .

For structural studies requiring properly folded mammalian mitochondrial proteins, mammalian cell lines or insect cell expression systems may provide better results despite lower yields. These systems are more likely to properly incorporate the protein into membrane structures with appropriate post-translational modifications.

What methods can identify the ubiquinone binding sites in MT-ND4L?

A sophisticated approach for identifying ubiquinone binding sites involves photoaffinity labeling using specialized photoreactive ubiquinone (UQ) mimics. The methodology developed for NDH-2 enzymes provides a valuable template:

  • Synthesize photoreactive biotinylated UQ mimics following a "least modification" concept to maintain biological relevance

  • Allow the probe to interact with the purified protein under native conditions

  • Activate cross-linking through UV exposure

  • Cleave the labeled protein using CNBr and/or proteolytic enzymes (V8 protease, lysylendopeptidase)

  • Identify the labeled fragments through detection of the biotin tag

  • Sequence the fragments to determine the specific binding regions

This approach has successfully identified UQ binding regions in related proteins. For example, in one study, the binding site of the Q-ring was located in the sequence region between specific amino acid residues in NDH-2 . A similar methodology would be applicable to studies of MT-ND4L from Chalinolobus tuberculatus.

How can researchers effectively model the structure of Chalinolobus tuberculatus MT-ND4L?

For structural modeling of Chalinolobus tuberculatus MT-ND4L, the following methodological pipeline is recommended:

  • Template identification: Identify suitable structural templates from the Protein Data Bank. For instance, the human respiratory complex I (transmembrane arm, PDB ID: 5XTC) has been used successfully for modeling related proteins with high identity (98%) .

  • Homology modeling: Employ MODELLER or similar software to generate multiple potential structures. Generate approximately 50 models and select the model with the lowest DOPE (Discrete Optimized Protein Energy) score .

  • Model evaluation: Validate the quality of the model using:

    • PROCHECK for stereochemical quality assessment

    • QMEANBrane for transmembrane protein-specific validation

    • DOPE profile comparison between the model and template

  • Membrane system construction: Place the model in a lipid bilayer composed of POPC (1-palmitoyl-2-oleoylphosphatidylcholine), which constitutes approximately 40% of the inner mitochondrial membrane .

  • Molecular dynamics simulation: Run simulations using AMBER18 or similar software to analyze protein stability and dynamics within the membrane environment. Typically, 100ns simulation with 10,000 frames is sufficient for initial analysis .

How do specific mutations in MT-ND4L affect Complex I function?

Mutations in MT-ND4L can significantly impact protein structure and function, with potential pathological consequences. Molecular dynamics studies have demonstrated that even single amino acid substitutions can alter crucial interactions within the protein structure:

For example, the T10609C mutation (causing M47T substitution) disrupts hydrogen bonding patterns. In the native protein, Met47 forms hydrogen bonds with Thr51 and Asn50, creating a stable loop structure. The mutation to threonine reduces these hydrogen bonds, causing conformational changes that propagate through the protein structure .

Similarly, the C10676G mutation (causing C69W substitution) introduces a bulkier tryptophan residue that alters hydrophobic interactions. This change affects the organization of helical structures within the protein .

These structural changes can impact the proton translocation pathway at the interface between ND4L and ND6 subunits, potentially reducing Complex I efficiency. Researchers investigating Chalinolobus tuberculatus MT-ND4L should consider similar analytical approaches when assessing the impact of mutations identified in their studies.

What role does MT-ND4L play in mitochondrial disorders?

MT-ND4L mutations have been implicated in several mitochondrial disorders. Most notably, a specific mutation in MT-ND4L (T10663C or Val65Ala) has been identified in families with Leber hereditary optic neuropathy, a condition characterized by vision loss .

The mechanisms by which MT-ND4L mutations lead to disease are not fully understood, but likely involve disruption of:

  • Electron transport efficiency

  • Proton translocation

  • Complex I assembly or stability

  • Reactive oxygen species production

For researchers studying Chalinolobus tuberculatus MT-ND4L, investigating whether any species-specific variants affect these functions could provide insights into both evolutionary adaptations and potential links to conservation biology concerns in this vulnerable bat species.

How can molecular dynamics simulations enhance understanding of MT-ND4L function?

Molecular dynamics (MD) simulations offer powerful insights into the structure-function relationships of MT-ND4L:

The methodology involves:

  • Building a transmembrane system with the protein embedded in a POPC lipid bilayer to mimic the mitochondrial inner membrane

  • Solvating the system with water molecules and appropriate counter-ions

  • Energy minimization and equilibration

  • Production MD runs (typically 100ns or longer)

  • Analysis of trajectories using tools such as RMSD (root-mean-square deviation) and RMSF (root-mean-square fluctuation)

These simulations can specifically investigate:

  • Proton translocation pathways by tracking hydrogen bond networks and water molecule movements

  • Effects of mutations on protein stability and function

  • Interactions between MT-ND4L and other Complex I subunits

  • Conformational changes during electron transport

For example, MD simulations have revealed that key residues in ND4L (such as Glu34) form hydrogen bonds with residues in ND6 (such as Tyr157) that may be critical for proton translocation . Similar approaches would be valuable for studying Chalinolobus tuberculatus MT-ND4L.

What approaches can help resolve contradictions in experimental data regarding MT-ND4L function?

When encountering contradictory experimental results in MT-ND4L research, consider implementing the following analytical framework:

  • Cross-validation using multiple techniques:

    • Combine biochemical assays with structural studies

    • Verify in vitro findings with in vivo experiments

    • Support experimental data with computational modeling

  • Controlled mutagenesis studies:

    • Create systematic mutations to map functional domains

    • Use site-directed mutagenesis to test specific hypotheses

    • Compare results across different expression systems

  • Evolutionary analysis:

    • Examine conservation patterns across species

    • Identify functionally critical residues through comparative genomics

    • Consider the evolutionary context of Chalinolobus tuberculatus

  • Integration of literature data:

    • Review established functions of MT-ND4L across species

    • Compare experimental conditions that may explain contradictions

    • Consider species-specific adaptations that might alter function

How should researchers design experiments to study the interaction between MT-ND4L and other Complex I subunits?

To effectively study interactions between MT-ND4L and other Complex I subunits:

  • Co-immunoprecipitation studies:

    • Use antibodies against MT-ND4L or interacting partners

    • Identify protein complexes through mass spectrometry

    • Verify interactions through reciprocal precipitation

  • Cross-linking experiments:

    • Apply chemical cross-linkers to stabilize transient interactions

    • Identify cross-linked residues through mass spectrometry

    • Map interaction surfaces based on cross-linking patterns

  • FRET (Förster Resonance Energy Transfer) analysis:

    • Create fluorescently tagged versions of MT-ND4L and potential partners

    • Measure energy transfer as indication of proximity

    • Use in living cells to capture dynamic interactions

  • Computational docking and simulation:

    • Model interactions between MT-ND4L and other subunits

    • Simulate the dynamics of these interactions

    • Identify key residues for experimental validation

  • Hydrogen bond analysis:

    • Calculate hydrogen bonds between interacting residues

    • Use a short-range cutoff (e.g., 3.0 Å) to identify significant interactions

    • Analyze multiple frames from molecular dynamics simulations

What data analysis approaches are most effective for interpreting MT-ND4L structural studies?

When analyzing structural data for MT-ND4L, researchers should consider these approaches:

How might recombinant Chalinolobus tuberculatus MT-ND4L contribute to conservation biology?

Recombinant MT-ND4L from Chalinolobus tuberculatus could provide insights into bat-specific mitochondrial adaptations. While the search results don't directly address this application, the following research directions could be valuable:

  • Comparative studies of MT-ND4L across bat species with different metabolic demands (e.g., hibernating vs. non-hibernating species)

  • Investigation of potential MT-ND4L adaptations that might support the high energy demands of flight in bats

  • Assessment of MT-ND4L variants in Chalinolobus tuberculatus populations to identify potential vulnerabilities to environmental stressors

  • Development of biomarkers for monitoring mitochondrial health in wild bat populations

What emerging technologies might enhance MT-ND4L research in the coming years?

Several emerging technologies show promise for advancing MT-ND4L research:

  • Cryo-electron microscopy for high-resolution structural determination of membrane protein complexes containing MT-ND4L

  • CRISPR-Cas9 gene editing for creating precise mutations to study MT-ND4L function in cellular models

  • Single-molecule techniques to track electron transfer and conformational changes in real-time

  • Advanced computational methods, including quantum mechanics/molecular mechanics (QM/MM) simulations for more accurate modeling of electron transfer processes

  • Nanoscale respirometry to measure the functional impact of MT-ND4L variants on mitochondrial respiration

How can models of MT-ND4L be integrated with broader mitochondrial research?

MT-ND4L research can be integrated into broader mitochondrial studies through:

  • Systems biology approaches that model the entire electron transport chain function

  • Integration of MT-ND4L structural studies with whole Complex I functional analyses

  • Correlation of MT-ND4L variants with mitochondrial disease phenotypes

  • Examination of MT-ND4L within the context of mitochondrial evolution across species

  • Integration with mitoproteomics data to understand the dynamic protein interactions within mitochondria

Table 1: MT-ND4L Gene Characteristics in Mitochondrial Genome

FeatureDetails
Position in Mitochondrial Genome9880-10,173
Length (bp)294
Start CodonATG
Stop CodonTAA
Strand+
Upstream GeneND3
Downstream GeneND4
Overlap with ND4Present (ND4 starts at position 10,170)

Data compiled from mitochondrial genome information

Table 2: Key Residues in MT-ND4L Involved in Protein Function

ResidueFunctionInteractionsEffect when Mutated
Glu34Proton translocationForms hydrogen bonds with Tyr157 (ND6)Potential disruption of proton pathway
Met47Structural integrityForms hydrogen bonds with Thr51 and Asn50M47T mutation reduces hydrogen bonds and alters conformation
Cys69Structural stabilityForms hydrophobic interactionsC69W mutation introduces bulkier side chain affecting helix organization

Data derived from molecular dynamics simulation studies

Table 3: Methodological Approaches for MT-ND4L Research

MethodApplicationKey ParametersExpected Outcomes
Photoaffinity LabelingUbiquinone binding site identificationPhotoreactive biotinylated UQ mimic, CNBr cleavageIdentification of specific binding regions
Homology ModelingStructural predictionPDB template (e.g., 5XTC), MODELLER software3D structural model with >90% residues in favorable regions
Molecular DynamicsMutation effect analysisAMBER18, POPC lipid bilayer, 100ns simulationRMSD/RMSF values, hydrogen bond patterns, conformational changes
Hydrogen Bond AnalysisInteraction assessment3.0Å cutoff, analysis of 10,000 simulation framesNetwork of interactions between key residues

Methods compiled from research approaches in related studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.