Recombinant Chapare virus Pre-glycoprotein polyprotein GP complex (GPC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
251-484
Protein Length
full length protein
Species
Chapare mammarenavirus (isolate Human/Bolivia/810419/2003)
Target Names
GPC
Target Protein Sequence
GVFTWTITDAAGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLNHDSEFCDMLKLFEFN KKAIESLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLDTPYCNYTKFWYVNHTITGE HSLPRCWMVKNNSYLNESEFRNDWILESDHLLSEMLNKEYFDRQGKTPITLVDICFWSTL FFTTTLFLHLVGFPTHRHIQGEPCPLPHKLNSNGGCRCGRYPELKKPTTWHRKH
Uniprot No.

Target Background

Function
This class I viral fusion protein mediates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. Membrane fusion results from irreversible conformational changes triggered by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide while also remaining a component of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational GP1/GP2 cleavage, glycoprotein transport to the cell membrane, infectious virion formation, and acid pH-dependent cell fusion mediated by the glycoprotein. It also interacts with the host receptor.
Database Links

KEGG: vg:6216304

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and organization of Chapare virus pre-glycoprotein polyprotein complex (GPC)?

Chapare virus GPC shares structural similarities with other New World arenaviruses, particularly those in clade B. The arenavirus envelope glycoprotein GP is the sole protein on the virion surface and undergoes processing into three noncovalently associated subunits: the stable signal peptide (SSP), GP1, and GP2 . The GP1 subunit mediates cell attachment through interaction with transferrin receptor 1 (TfR1), while GP2 is responsible for membrane fusion activities. Unlike conventional signal peptides, the SSP remains on the surface of virions and participates in maturation and pH-dependent membrane-fusion activity of the GP complex . This tripartite structure is essential for viral infectivity and host cell invasion.

What are the key functional domains within Chapare virus GPC that determine its biological properties?

The functional domains of Chapare virus GPC can be divided into three primary regions: (1) the receptor-binding GP1 domain, which determines host tropism and cellular entry; (2) the fusion-mediating GP2 domain, responsible for membrane fusion after endocytosis; and (3) the stable signal peptide (SSP), which regulates the pH-dependent activation of membrane fusion . Within GP1, specific loop structures interact with host receptors, particularly at the apical domain of TfR1 . These interaction sites are critical determinants of zoonotic potential and cross-species transmission. The GP2 domain contains a fusion peptide and heptad repeats that undergo conformational changes during the fusion process. Proper spatial arrangement of these domains is essential for viral entry and represents potential targets for antiviral interventions.

What cellular mechanisms are involved in the processing of Chapare virus GPC?

The processing of Chapare virus GPC, like other arenaviruses, likely involves co- and post-translational cleavage by host cell proteases . The precursor contains signal peptides essential for endoplasmic reticulum (ER) membrane translocation and protein maturation . The nascent precursor signal peptide binds to signal recognition particles, guiding the ribosome toward the ER where the signal peptide becomes inserted into the membrane, directing the polypeptide into the ER lumen during translation . Signal peptidases (SPase) co-translationally cleave the signal peptide from the polypeptide chain . Further processing likely occurs in the Golgi complex, where specific proteases, possibly including SKI-1/S1P-like proteases or furin-like proprotein convertases (as seen in other arenaviruses), may cleave the precursor into mature GP1 and GP2 . This multi-step processing is critical for producing functional viral glycoproteins capable of mediating host cell entry.

How do post-translational modifications affect Chapare virus GPC function?

Post-translational modifications, particularly N-linked glycosylation, play crucial roles in Chapare virus GPC folding, stability, and function. Based on structural studies of related arenaviruses, multiple N-linked glycosylation sites exist within both GP1 and GP2 domains . These glycans contribute to proper protein folding in the ER, protection from proteolytic degradation, and evasion of host immune responses. Additionally, glycosylation patterns can influence receptor recognition and binding affinity. When expressing recombinant Chapare virus GPC for research purposes, it's essential to utilize expression systems that support appropriate glycosylation patterns, such as mammalian or insect cell systems, which maintain glycosylation sites similar to those observed in MACV GP1 (positions 95, 137, 166, and 178) . Experimental studies examining the functional impacts of removing specific glycosylation sites could provide valuable insights into their roles in virus-receptor interactions.

What proteolytic enzymes are involved in Chapare virus GPC maturation?

While specific proteases involved in Chapare virus GPC processing have not been definitively characterized, insights from related New World arenaviruses suggest involvement of multiple cellular proteases. Signal peptidases in the ER likely mediate initial cleavage of signal sequences . Further processing may involve subtilisin-like proprotein convertases such as SKI-1/S1P, which processes other arenavirus GPCs at conserved motifs (e.g., RRLL in nairoviruses) . Furin-like proteases may also participate in processing at multibasic sites (e.g., RSKR motifs) . Signal peptide peptidases (SPP) or SPP-like proteases (SPPLs) may remove residual signal peptides from cytoplasmic tails of glycoproteins . Experimental approaches to identify specific proteases involved could include using protease inhibitors, siRNA knockdown of candidate proteases, or in vitro cleavage assays with recombinant proteases and GPC substrates.

What structural features determine Chapare virus GP1 interaction with human TfR1?

The structural basis for Chapare virus GP1 interaction with human transferrin receptor 1 (TfR1) likely resembles that of other New World arenaviruses like Machupo virus, while maintaining distinctive features that reflect its unique evolutionary history . In Machupo virus, the GP1 subunit forms contacts with TfR1 primarily through the apical domain of the receptor, with key interaction points involving the loop between TfR1 βII-1 and βII-2 strands . Computational analysis suggests that Chapare virus GP1 contains similar structural motifs that facilitate TfR1 binding, although the specific contact residues may differ . The virus-receptor interface likely involves a combination of hydrogen bonds, salt bridges, and van der Waals interactions that collectively determine binding affinity and specificity. Based on homology modeling and docking studies, certain residues in the Chapare virus GP1 may engage with human TfR1 residues that are distinct from those used by other arenaviruses, potentially explaining differences in host range and pathogenicity .

How does genetic variation in human TfR1 affect Chapare virus entry?

Genetic variation in human TfR1 can significantly impact Chapare virus entry efficiency. Single nucleotide polymorphisms (SNPs) in human TfR1, particularly within the apical domain that interacts with viral glycoproteins, may alter the binding interface and subsequently affect viral entry . For example, the human SNP L212V has been shown to reduce Machupo virus entry while enhancing entry by Junín and Sabiá arenaviruses . This suggests that similar variations could differentially affect Chapare virus tropism and highlights the possibility of evolutionary trade-offs, where selection for resistance to one arenavirus might increase susceptibility to others . Research methodologies to investigate these effects include pseudovirus entry assays using cells expressing TfR1 variants, binding assays with recombinant GP1-Ig fusion proteins, and computational modeling of binding energies between Chapare virus GP1 and TfR1 variants . Understanding these genetic determinants of susceptibility could help identify individuals at higher risk during outbreaks.

What experimental approaches can effectively measure Chapare virus GP1-TfR1 binding interactions?

Several experimental approaches can effectively measure Chapare virus GP1-TfR1 binding interactions:

  • GP1Δ-Ig fusion protein binding assays: Similar to those used for MACV, JUNV, and GTOV, recombinant Chapare virus GP1 can be expressed as an immunoglobulin fusion protein (GP1Δ-Ig) and used in flow cytometry-based binding assays with cells expressing TfR1 variants . This approach allows quantification of binding through detection with fluorescently labeled anti-human IgG antibodies.

  • Surface plasmon resonance (SPR): Purified recombinant Chapare virus GP1 and TfR1 ectodomain can be used to measure binding kinetics and affinity constants, providing detailed information about association and dissociation rates.

  • Pseudovirus entry assays: MLV-based pseudoviruses bearing Chapare virus glycoproteins can be generated to assess entry efficiency in cells expressing different TfR1 variants . Entry can be quantified using reporter genes like GFP, allowing correlation between binding affinity and functional entry.

  • Computational modeling and docking: Homology models of Chapare virus GP1 can be docked to TfR1 structures, and binding energies calculated using scoring functions like the Rosetta interface scoring function . This approach can predict relative binding affinities that correlate with experimental results.

Experimental MethodAdvantagesLimitationsKey Measurements
GP1Δ-Ig Binding AssaysCellular context; high throughputSemi-quantitativeRelative binding strength
Surface Plasmon ResonancePrecise kinetic parameters; label-freeRequires purified proteinsK<sub>D</sub>, k<sub>on</sub>, k<sub>off</sub>
Pseudovirus Entry AssaysFunctional relevance; biosafetyIndirect measure of bindingEntry efficiency (% GFP+ cells)
Computational ModelingPredictive; structure-based insightsRequires validationRelative binding energies (REU)

What expression systems are optimal for producing functional recombinant Chapare virus GPC?

The choice of expression system for producing recombinant Chapare virus GPC depends on research objectives and downstream applications. Based on successful approaches with other arenavirus glycoproteins, several systems can be considered:

  • Mammalian cell expression systems: Human embryonic kidney (HEK) 293T cells have proven effective for expressing arenavirus glycoproteins with native-like post-translational modifications . These cells support proper folding, glycosylation, and proteolytic processing of complex viral glycoproteins. For soluble GP1 domain expression, adding a C-terminal tag (e.g., hexahistidine) facilitates purification .

  • Insect cell expression systems: Successful expression of MACV GP1 has been achieved in insect cells, which provide advantages of higher yield while maintaining most mammalian-type glycosylation patterns . Baculovirus expression vectors carrying the GP1 coding sequence (with appropriate signal sequences and purification tags) can be used to infect Sf9 or High Five insect cells.

  • Bacterial expression systems: Generally less suitable for full-length GPC due to lack of glycosylation machinery, but may be appropriate for expressing non-glycosylated domains or peptides for specific applications such as antibody generation or structural studies of isolated domains.

The expression construct design should include appropriate signal sequences for secretion or membrane targeting, and consideration of codon optimization for the chosen expression system. For functional studies, mammalian expression systems generally provide the most physiologically relevant post-translational modifications and processing.

What purification strategies yield high-quality recombinant Chapare virus glycoproteins?

Effective purification of recombinant Chapare virus glycoproteins requires a multi-step approach that preserves protein structure and function:

  • Initial capture: For His-tagged constructs, nickel-affinity chromatography provides an effective first step . Conditions should be optimized to minimize non-specific binding while maximizing target protein recovery. For secreted proteins, concentration of culture supernatants may be necessary before chromatography.

  • Proteolytic processing: If tag removal is desired, specific proteases like elastase can be used to remove purification tags while preserving the native protein . Site-specific proteases provide controlled cleavage at engineered sites.

  • Size exclusion chromatography: This step separates monomeric from aggregated protein and removes remaining contaminants based on molecular size . It also allows buffer exchange into physiologically relevant conditions for downstream applications.

  • Quality control: Assessment of purity by SDS-PAGE, glycosylation status by glycosidase treatment, and functional activity through binding assays are essential to ensure that the purified protein retains native-like properties.

For complex formations (e.g., GP1-TfR1 complexes), proteins can be mixed in equimolar ratios after individual purification and subjected to additional size exclusion chromatography to isolate the complex . Optimizing buffer conditions (pH, ionic strength, additives) at each step is crucial for maintaining protein stability and preventing aggregation.

What strategies can overcome challenges in expressing the full-length Chapare virus GPC?

Expressing full-length Chapare virus GPC presents several challenges due to its complex processing requirements and potential cytotoxicity. These challenges can be addressed through:

  • Inducible expression systems: Using tetracycline-regulated or other inducible promoters allows control over expression timing and level, reducing potential cytotoxic effects during cell growth.

  • Co-expression of processing proteases: Ensuring appropriate processing enzymes are present in the expression system can improve maturation of the GPC. This might involve co-transfection with plasmids encoding relevant proteases if the host cells lack sufficient endogenous activity.

  • Chimeric constructs: Creating chimeras with well-characterized arenavirus GPCs, where problematic domains are replaced with those from Chapare virus, can improve expression while maintaining regions of interest for study.

  • Optimized signal sequences: Employing signal sequences known to work efficiently in the chosen expression system can improve translocation into the ER and subsequent processing.

  • Stabilizing mutations: Introducing specific mutations that enhance protein stability without affecting function can improve yield. These might include removal of proteolytically sensitive sites not essential for function or introduction of stabilizing interactions.

For structural studies, expression of individual domains (GP1 or GP2) rather than the full GPC may be more practical, as demonstrated in the successful crystallization of MACV GP1 with human TfR1 . These approaches must be balanced against the need to maintain authentic structural and functional properties relevant to the research question.

How can recombinant Chapare virus GPC be used to study viral pathogenesis?

Recombinant Chapare virus GPC serves as a valuable tool for investigating multiple aspects of viral pathogenesis through these methodological approaches:

  • Receptor usage and host range studies: Recombinant GP1-Ig fusion proteins can be used to screen cells from different species for potential receptors, helping to identify natural reservoir hosts and assess zoonotic potential . By testing binding to TfR1 orthologs from various rodent species, researchers can map potential transmission pathways in nature.

  • Entry inhibitor screening: Pseudoviruses bearing Chapare virus GPC provide a safe system for high-throughput screening of compounds that block viral entry. This approach allows identification of small molecules or peptides that disrupt GPC-TfR1 interactions or prevent conformational changes required for fusion.

  • Neutralizing antibody epitope mapping: Recombinant GPC or GP1 can be used in combination with monoclonal antibodies to map neutralizing epitopes through techniques such as competition binding assays, escape mutant selection, and hydrogen-deuterium exchange mass spectrometry. This information is crucial for understanding protective immunity and vaccine design.

  • Structure-function analysis through mutagenesis: Site-directed mutagenesis of recombinant GPC, followed by functional assays, can identify critical residues involved in receptor binding, fusion activation, or antibody recognition. Such studies provide molecular insights into viral entry mechanisms.

  • Cell tropism determination: Using pseudotyped viruses expressing GPC in combination with various cell types can reveal the cellular tropism of Chapare virus, which informs understanding of disease pathogenesis and tissue specificity.

These approaches collectively contribute to a comprehensive understanding of how Chapare virus GPC mediates host cell invasion and influences pathogenicity.

What methods effectively assess receptor-binding properties of Chapare virus GPC variants?

Assessment of receptor-binding properties of Chapare virus GPC variants requires a multi-faceted experimental approach:

  • GP1Δ-Ig binding assays: By generating GP1Δ-Ig fusion proteins containing mutations of interest, researchers can quantitatively compare binding to cells expressing TfR1 using flow cytometry . This method allows rapid screening of multiple variants and assessment of how specific mutations affect receptor recognition.

  • SPR binding kinetics: Surface plasmon resonance with purified GP1 variants and TfR1 ectodomain provides detailed kinetic parameters (k<sub>on</sub>, k<sub>off</sub>, and K<sub>D</sub>) that quantify the impact of mutations on binding affinity and stability of the virus-receptor complex.

  • Pseudovirus entry assays: MLV-based pseudoviruses bearing GPC variants can be used to assess how binding properties translate to functional entry capacity . By comparing GFP reporter expression in cells expressing TfR1, researchers can correlate binding affinity with entry efficiency.

  • Computational binding energy prediction: Homology modeling of GPC variants followed by docking to TfR1 structures can predict binding energies using scoring functions like Rosetta . This computational approach allows rapid screening of variants and generates hypotheses that can be validated experimentally.

  • Co-immunoprecipitation assays: Pull-down experiments with tagged GPC variants and TfR1 can assess complex formation under various conditions, providing information about stability of the interaction.

The correlation between binding affinity and entry efficiency should be systematically analyzed, as the relationship may not be linear—some mutations might affect binding without proportionally affecting entry, suggesting additional functional roles beyond initial receptor recognition.

How can structural data from recombinant Chapare virus GPC inform vaccine design?

Structural data derived from recombinant Chapare virus GPC provides critical insights that can guide rational vaccine design through several approaches:

  • Identification of neutralizing epitopes: Crystallographic structures of Chapare virus GP1-TfR1 complexes, similar to the MACV GP1-hTfR1 structure (PDB: 3KAS) , can reveal surface-exposed regions accessible to antibodies. These regions, particularly those involved in receptor binding, often represent vulnerable sites for neutralization.

  • Design of stabilized immunogens: Understanding the prefusion conformation of GPC enables the design of stabilized immunogens that present critical epitopes in their native state. This might involve introducing disulfide bonds or other modifications that prevent premature conformational changes that could expose non-neutralizing epitopes.

  • Structure-guided immunogen optimization: Structural data allows precise engineering of immunogens to focus immune responses on conserved epitopes shared among New World arenaviruses, potentially creating broadly protective vaccines. This might involve designing chimeric glycoproteins that maintain the conserved structural scaffold while presenting multiple variant epitopes.

  • Epitope-specific nanoparticle vaccines: Key neutralizing epitopes identified through structural studies can be presented on nanoparticle platforms in optimal orientation and density to enhance B-cell activation and antibody production.

  • Prediction of antigenic drift: By mapping sequence variation among Chapare virus isolates onto the three-dimensional structure, researchers can predict regions prone to antigenic drift and design vaccines that target more conserved epitopes, potentially providing broader protection against emerging variants.

The structural comparison between Chapare virus GPC and other arenavirus glycoproteins also facilitates understanding of cross-reactivity patterns of antibodies, which is essential for developing pan-arenavirus vaccines or treatments effective against multiple New World hemorrhagic fever viruses.

How does positive selection analysis inform understanding of Chapare virus GPC evolution?

Positive selection analysis provides crucial insights into the evolutionary forces shaping Chapare virus GPC and its adaptation to different host species:

  • Identification of functionally important regions: Residues under positive selection (exhibiting higher rates of non-synonymous than synonymous substitutions) often represent sites of host-pathogen interactions subject to selective pressure . In New World arenaviruses, such analysis has identified small protein motifs in GP1 that are critical for receptor binding and host specificity.

  • Tracking adaptive evolution: By comparing sequences of Chapare virus GPC with those from other New World arenaviruses and mapping selection signatures onto structural models, researchers can trace the virus's evolutionary history and adaptation to different rodent hosts. This approach helps identify parallel evolutionary events that facilitate zoonotic transmission.

  • Predicting zoonotic potential: Positive selection at sites involved in TfR1 binding can indicate adaptation that might facilitate cross-species transmission . By identifying such signatures in Chapare virus isolates from rodents, researchers can assess their potential to infect humans through computational modeling of GP1-human TfR1 interactions.

  • Evolutionary trade-offs: Selection for mutations that enhance binding to specific host receptors may come with fitness costs in other contexts, creating evolutionary trade-offs . Understanding these trade-offs helps predict constraints on viral evolution and potential transmission barriers.

Methodologically, performing positive selection analysis requires:

  • Sequence alignment of GPC from multiple Chapare virus isolates and related arenaviruses

  • Application of statistical models (e.g., PAML, HyPhy) to identify sites with dN/dS ratios >1

  • Mapping selected sites onto structural models to interpret their functional significance

  • Experimental validation of computational predictions through mutagenesis and functional assays

What are the most effective pseudotyping systems for studying Chapare virus entry mechanisms?

Several pseudotyping systems offer advantages for studying Chapare virus entry mechanisms, each with specific methodological considerations:

  • MLV-based pseudotyping system: This well-established approach has been successfully used with other New World arenaviruses . The methodology involves:

    • Co-transfection of cells with plasmids encoding Chapare virus GPC, MLV gag and pol genes, and a retroviral vector expressing a reporter gene (GFP)

    • Harvesting pseudovirus-containing supernatants 24-48 hours post-transfection

    • Filtering through 0.45-μm filters to remove cellular debris

    • Infecting target cells expressing various TfR1 constructs

    • Measuring reporter gene expression (e.g., GFP) by flow cytometry 48 hours post-infection

  • VSV-based pseudotyping system: Offers higher titers and more rapid readout than MLV systems:

    • Using recombinant VSV with its G protein gene deleted and replaced with a reporter gene

    • Transfecting cells with Chapare virus GPC plasmid, then infecting with the G-deleted VSV

    • Collecting and titrating the resulting pseudoviruses on permissive cells

  • Lentiviral pseudotyping system: Provides advantages for infecting non-dividing cells:

    • Co-transfecting cells with Chapare virus GPC plasmid, HIV-1 packaging plasmids, and a lentiviral transfer vector encoding a reporter

For all systems, appropriate controls are essential:

  • Pseudoviruses bearing VSV-G as positive control for entry

  • No-envelope pseudoviruses as negative control

  • Well-characterized arenavirus GPCs (e.g., MACV, JUNV) for comparison

Pseudotyping SystemAdvantagesLimitationsBest Applications
MLV-basedWell-established for arenaviruses; stableRequires cell division for integrationReceptor usage studies; entry inhibitor screening
VSV-basedHigher titers; rapid readout (12-24h)Cytopathic effect; potential backgroundHigh-throughput screening; kinetic studies
LentiviralInfects non-dividing cellsMore complex productionIn vivo studies; primary cell infections

What computational models best predict Chapare virus GPC interactions with potential host receptors?

Computational modeling approaches for predicting Chapare virus GPC interactions with potential host receptors should integrate structural, evolutionary, and biophysical data:

  • Homology modeling and rigid-body docking: For Chapare virus GP1, homology models can be developed based on the crystal structure of MACV GP1 (PDB: 3KAS) . These models can then be docked to TfR1 structures from various potential host species using molecular docking software such as Rosetta, HADDOCK, or ClusPro . The accuracy of such models can be enhanced by incorporating constraints derived from evolutionary data and experimental binding studies.

  • Binding energy calculations: The Rosetta interface scoring function has shown good agreement with experimental results for other arenavirus-receptor interactions . This approach calculates binding energies between modeled GPC variants and receptor structures, providing quantitative predictions of interaction strength. The methodology involves:

    • Generating multiple docked conformations

    • Scoring interfaces using energy functions that account for hydrogen bonding, electrostatics, van der Waals forces, and solvation

    • Correlating calculated energies with experimental binding or entry data

  • Molecular dynamics simulations: To assess the stability and dynamics of predicted GP1-receptor complexes:

    • Performing all-atom MD simulations of docked complexes in explicit solvent

    • Analyzing trajectory stability, conformational changes, and persistence of key interactions

    • Calculating binding free energies using methods like MM/PBSA or FEP

  • Evolutionary coupling analysis: Coevolutionary signals between virus and host proteins can identify interacting residues:

    • Analyzing patterns of correlated mutations in virus-host protein pairs

    • Integrating these constraints into docking models

    • Using direct coupling analysis (DCA) or related methods to predict contact maps

  • Machine learning approaches: Training ML models on existing virus-receptor interaction data to predict novel interactions:

    • Featuring engineering based on physicochemical properties, sequence patterns, and structural information

    • Validating predictions with experimental binding and entry assays

The most effective approach combines these computational methods with targeted experimental validation, creating an iterative workflow where computational predictions guide experimental design, and experimental results refine computational models. This integrated strategy has successfully identified determinants of arenavirus host specificity and accurately predicted receptor compatibility across species barriers .

What biosafety considerations are important when working with recombinant Chapare virus glycoproteins?

Working with recombinant Chapare virus glycoproteins requires careful attention to biosafety considerations, given that the intact virus is classified as a BSL-4 pathogen. Key methodological approaches to ensure safe research include:

  • Risk assessment and containment level determination:

    • Recombinant glycoproteins alone cannot cause infection and generally can be handled at BSL-2

    • Pseudotyped viruses bearing Chapare virus GPC typically require BSL-2 containment with enhanced precautions

    • Any work involving infectious Chapare virus requires BSL-4 facilities

    • Comprehensive risk assessment should be performed before initiating research, considering the specific constructs and experimental systems

  • Design of safer experimental systems:

    • Using replication-incompetent pseudovirus systems rather than infectious virus

    • Employing truncated or modified GPC constructs that lack full functionality where possible

    • Creating chimeric proteins where only domains of interest from Chapare virus are expressed

  • Laboratory practices and personal protective equipment:

    • Training personnel in proper handling of potentially hazardous biological materials

    • Using appropriate personal protective equipment, including gloves, lab coats, and eye protection

    • Conducting all procedures in certified biological safety cabinets

    • Implementing strict waste management protocols

  • Institutional oversight and regulatory compliance:

    • Obtaining approval from institutional biosafety committees before initiating work

    • Ensuring compliance with national regulations regarding recombinant DNA research

    • Maintaining detailed records of all experiments and safety protocols

    • Regular safety audits and updates to procedures based on emerging knowledge

These approaches allow researchers to study important aspects of Chapare virus biology while minimizing risks to laboratory workers and the environment. The pseudotyped virus systems described in previous sections provide particularly valuable tools for studying viral entry without the need for BSL-4 containment .

How can structural comparisons between arenavirus GPCs inform therapeutic development?

Structural comparisons between arenavirus GPCs provide critical insights for therapeutic development through several methodological approaches:

  • Identification of conserved druggable pockets:

    • Aligning crystal structures of different arenavirus GPCs (such as MACV GP1-hTfR1 complex, PDB: 3KAS) to identify conserved structural features

    • Using computational pocket detection algorithms to identify potential binding sites for small molecules

    • Focusing on pockets that are conserved across pathogenic New World arenaviruses but show structural differences from human proteins

  • Structure-based design of broad-spectrum entry inhibitors:

    • Targeting the GP1-TfR1 interface with small molecules or peptides that disrupt critical interactions

    • Designing inhibitors that bind conserved regions of GP2 to prevent the conformational changes required for fusion

    • Developing compounds that stabilize the prefusion conformation of GPC to prevent activation

  • Monoclonal antibody development:

    • Using structural data to identify epitopes that are conserved across multiple arenaviruses

    • Engineering antibodies to target these conserved epitopes with high affinity

    • Creating bispecific antibodies that simultaneously target multiple epitopes to prevent escape mutations

  • Therapeutic targeting of host factors:

    • Identifying host proteases involved in GPC processing based on structural motifs at cleavage sites

    • Developing selective inhibitors of these proteases as potential broad-spectrum antivirals

    • Modulating TfR1 expression or accessibility without disrupting its physiological function

The structural comparison methodology involves:

  • Superimposing available crystal structures using structural alignment algorithms

  • Creating homology models for GPCs lacking experimental structures

  • Mapping sequence conservation onto these structures to identify regions under functional constraints

  • Correlating structural features with functional data from mutagenesis and entry studies

This integrated approach has already yielded promising results for related arenaviruses and could lead to therapies effective against multiple hemorrhagic fever viruses, including Chapare virus.

How might climate change and ecological disruption affect Chapare virus host range and zoonotic potential?

Climate change and ecological disruption may significantly impact Chapare virus host range and zoonotic potential through several interconnected mechanisms. Methodological approaches to study these effects include:

  • Ecological niche modeling of reservoir hosts:

    • Collecting geographic and climate data associated with current Chapare virus reservoir distribution

    • Using machine learning algorithms to model the ecological niches of these hosts

    • Projecting how these niches might shift under various climate change scenarios

    • Identifying areas of potential range expansion that overlap with human populations

  • Experimental assessment of virus-host adaptation:

    • Testing the ability of Chapare virus GPC to bind TfR1 orthologs from multiple rodent species using GP1Δ-Ig binding assays

    • Measuring entry efficiency in cells expressing various TfR1 orthologs using pseudovirus systems

    • Evaluating how temperature variations affect viral replication and GPC processing

    • Investigating whether environmental stressors alter host susceptibility

  • Evolutionary forecasting:

    • Applying positive selection analysis to identify rapidly evolving regions in Chapare virus GPC

    • Modeling potential adaptive mutations that could enhance cross-species transmission

    • Using computational binding energy predictions to assess how specific mutations might affect receptor compatibility

    • Monitoring viral sequences from wild rodent populations to detect emerging adaptive mutations

  • Surveillance and risk assessment:

    • Establishing sentinel surveillance in regions predicted to become suitable for virus or host expansion

    • Developing rapid molecular diagnostic tools targeting conserved regions of the viral genome

    • Creating risk maps that integrate ecological, climatic, and socioeconomic factors

    • Implementing targeted surveillance in human populations with increased contact with potential reservoir species

This multidisciplinary approach can help predict how climate change might affect Chapare virus emergence and spread, enabling proactive public health measures. The structural and functional studies of Chapare virus GPC provide essential baseline data for understanding how future evolutionary changes might impact viral tropism and pathogenicity in new host environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.