Recombinant Chara vulgaris Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Chara vulgaris Apocytochrome f (petA)

Recombinant Chara vulgaris Apocytochrome f, commonly referred to as petA, is a protein derived from the green alga Chara vulgaris. This apocytochrome f is a component of the electron transport chain located in the thylakoid membranes of chloroplasts, playing a critical role in photosynthesis by facilitating electron transfer during the light reactions. The petA gene encodes for this protein, which is essential for the proper functioning of photosynthetic processes in plants and algae.

Molecular Structure and Function

Apocytochrome f is characterized by its heme-binding domain, which is crucial for its electron transport function. The structure of apocytochrome f includes:

  • Heme Group: A prosthetic group that allows for electron transfer.

  • Transmembrane Domain: Facilitates integration into the thylakoid membrane.

  • C-terminal Domain: Involved in protein-protein interactions within the electron transport chain.

The primary function of apocytochrome f is to shuttle electrons between plastocyanin and photosystem I, thereby contributing to the generation of ATP and NADPH during photosynthesis.

Recombinant Production

The production of recombinant apocytochrome f involves several steps:

  • Gene Cloning: The petA gene is amplified using polymerase chain reaction (PCR) and cloned into an expression vector. This vector is then transformed into Escherichia coli for protein expression.

  • Induction of Protein Expression: The transformed bacteria are cultured under specific conditions that induce the expression of the recombinant protein, typically using isopropyl β-D-1-thiogalactopyranoside (IPTG).

  • Purification: Following expression, the protein is purified using techniques such as affinity chromatography.

Table 1: Overview of Recombinant Production Steps

StepDescription
Gene CloningAmplification and insertion into expression vector
InductionUse of IPTG to trigger protein synthesis
PurificationIsolation of recombinant protein via chromatography

Research Findings

Recent studies have highlighted various aspects of recombinant Chara vulgaris Apocytochrome f:

  • Functional Studies: Research indicates that recombinant apocytochrome f retains its electron transport functionality similar to its native form. Studies demonstrate that it effectively interacts with other components of the electron transport chain, such as plastocyanin and cytochrome b6f complexes.

  • Applications in Biotechnology: The ability to produce apocytochrome f recombinantly has significant implications for biotechnology, particularly in developing biofuels and enhancing photosynthetic efficiency in crops.

Table 2: Key Research Findings on Recombinant Apocytochrome f

StudyFindings
Ko and Straus (1987)Successful expression in E. coli
Gray (1992)Characterization of N-terminal domain
Afigen (2023)Development of ELISA kits for quantification

References

  1. Ko, K., & Straus, N. (1987). Expression of a Recombinant Fragment of Cytochrome f in E. coli.

  2. Gray, J.C. (1992). The role of apocytochrome f in photosynthesis.

  3. Afigen (2023). ELISA Recombinant Chara vulgaris Apocytochrome f (petA).

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-321
Protein Length
Full Length of Mature Protein
Species
Chara vulgaris (Common stonewort)
Target Names
petA
Target Protein Sequence
EAYPVFAQQAYKSPREATGRIVCANCHLAKKTVDIEVPQAVLPNTVFEAVVKIPYDMQLK QVLANGKKGNLNVAAVLILPEGFELAPPDRISPDIKEKIGNLSFQSYSPDQKNILVVGPV PGKKYSEITFPILSPDPSINKQTNFLKYPIYVGGNRGRGQIYLDGSKSNNTIYSSSAEGQ VVKIIRKEKGGYEIFIDTIDGRKITDIIPPGPEIIVSEGEFVKVDQPLTNNPNVGGFGQA NTEIVLQNPLRMEGLILFFISVILAQVFLVLKKKQFEKVQIAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its biological role?

Apocytochrome f is the protein product of the petA gene found in Chara vulgaris (Common stonewort), a freshwater green alga. In its mature form, this protein functions as cytochrome f, an essential component of the major redox complex in the thylakoid membrane of chloroplasts . The full-length mature protein spans amino acids 36-321 of the complete sequence and contains characteristic domains required for electron transport activity .

The primary biological function of cytochrome f is to participate in photosynthetic electron transport by mediating electron transfer between photosystem complexes. Research on related algal species has shown that cytochrome f plays a crucial role in maintaining photosynthetic efficiency under various environmental conditions .

Why study Chara vulgaris as a model organism?

Chara vulgaris offers several advantages as a research model:

  • Evolutionary significance: Chara belongs to the Charophytes, considered close relatives to land plants, making it valuable for studying the evolution of photosynthetic mechanisms .

  • Ecological adaptability: This species is cosmopolitan (found worldwide except Antarctica) and inhabits diverse freshwater environments, from ponds and ditches to rivers, displaying remarkable adaptability to various ecological conditions .

  • Physiological studies: Chara vulgaris can tolerate both soft and alkaline water conditions, making it suitable for investigating adaptive responses to different water chemistry parameters .

  • Conservation status: Unlike many research organisms, Chara vulgaris is widely distributed and not endangered, facilitating sample collection for research purposes .

How is recombinant Chara vulgaris Apocytochrome f typically produced?

The standard production method involves heterologous expression in E. coli systems. The mature protein (amino acids 36-321) is expressed with an N-terminal His-tag to facilitate purification . Research protocols typically follow these steps:

  • Cloning the petA gene into an appropriate expression vector

  • Transformation into competent E. coli cells

  • Induction of protein expression under optimized conditions

  • Cell harvesting and lysis

  • Protein purification via affinity chromatography using the His-tag

  • Quality assessment via SDS-PAGE (purity >90% recommended)

What are optimal storage conditions for recombinant Apocytochrome f?

Based on experimental protocols, the following storage recommendations maximize protein stability and functionality:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard)

  • Aliquot to avoid repeated freeze-thaw cycles

  • For working aliquots, store at 4°C for no more than one week

  • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as a storage buffer

How can researchers assess functional activity of the recombinant protein?

Functionality assessment should include multiple complementary approaches:

  • Spectroscopic analysis to verify proper folding and heme incorporation

  • Electron transport activity assays using artificial electron donors/acceptors

  • Interaction studies with other components of the photosynthetic electron transport chain

  • Reconstitution experiments in model membrane systems

For comparison studies, researchers should control for protein concentration, buffer composition, and environmental parameters such as pH and temperature that can affect electron transfer kinetics.

How does Apocytochrome f relate to heat shock response in algae?

Studies in related algal species (Chlorella saccharophila) have revealed intriguing connections between cytochrome f and heat shock responses:

  • Heat shock upregulates petA gene expression in Chlorella saccharophila

  • Heat shock triggers the release of cytochrome f from thylakoid membranes into the cytosol

  • Cytosolic cytochrome f appears to participate in signaling pathways related to programmed cell death (PCD) mechanisms

  • The protein exerts its role through modulation of transcription, translation, and intracellular localization

These findings suggest that Apocytochrome f may have dual functions - participating in electron transport under normal conditions while contributing to stress response signaling during heat shock. Researchers investigating Chara vulgaris should consider designing experiments to explore whether similar mechanisms exist in this species.

What role does Apocytochrome f play in chloroplast-mediated cell death?

Evidence from studies on Chlorella saccharophila suggests that cytochrome f participates in heat shock-induced programmed cell death pathways:

  • Heat-shocked cells release cytochrome f into the cytosol

  • Cytosolic extracts with elevated cytochrome f levels can trigger cell death when applied to healthy cell populations

  • The cell death process exhibits characteristics similar to metazoan PCD

  • Changes in chromatin condensation and chloroplast structure accompany this process

This suggests an evolutionary conservation of cell death mechanisms involving chloroplast proteins across photosynthetic eukaryotes. Researchers studying Chara vulgaris Apocytochrome f should investigate whether similar mechanisms operate in this species and examine potential protein partners that interact with cytochrome f during stress responses.

How can Apocytochrome f research contribute to understanding microtubule-associated processes?

While not directly related to Apocytochrome f, research on Chara vulgaris has revealed interesting connections between cytoskeletal elements and cellular processes:

Studies using propyzamide (a microtubule-disrupting agent) on Chara vulgaris demonstrated that microtubule disruption affects:

  • Nuclear structure and chromatin arrangement

  • Nuclear envelope integrity

  • Endoplasmic reticulum morphology

  • Mitochondrial organization

Researchers might investigate potential interactions between chloroplast proteins (including Apocytochrome f) and the cytoskeletal network during stress responses or developmental processes, which could reveal novel signaling pathways between organelles.

What are common challenges when working with recombinant Apocytochrome f?

Based on experimental protocols, researchers should anticipate and address these common issues:

  • Protein solubility challenges during expression

  • Inclusion body formation in bacterial expression systems

  • Maintaining proper protein folding during purification

  • Achieving high purity (>90%) for functional studies

  • Preventing aggregation during storage

  • Protein degradation during freeze-thaw cycles

Implementing quality control steps at each stage of the production process is essential for obtaining reliable experimental results.

How can researchers distinguish between functional and structural roles of Apocytochrome f?

Experimental approaches to differentiate between these roles include:

  • Site-directed mutagenesis to modify key functional residues while preserving structure

  • Comparative studies between wild-type and mutant forms

  • Structure determination in different redox states

  • Analysis of protein-protein interactions under normal versus stress conditions

  • Subcellular localization studies under different experimental conditions

Combining these approaches provides complementary data that can help delineate the multifunctional nature of this protein.

What controls should be included in studies investigating stress-induced relocalization of Apocytochrome f?

When investigating potential stress-induced changes in localization or function, researchers should include:

  • Time-course experiments to track the progression of changes

  • Appropriate temperature controls (since heat shock influences localization)

  • Organelle-specific markers to confirm subcellular localization

  • Quantitative analyses of protein levels in different cellular fractions

  • Viability assessments to correlate protein relocalization with cellular outcomes

  • Comparative analyses between different stress conditions (heat, oxidative stress, etc.)

These controls help establish causality between stress application, protein relocalization, and subsequent cellular responses.

How might comparative studies between Chara vulgaris and other photosynthetic organisms advance our understanding?

Comparative studies offer several promising research avenues:

  • Evolutionary insights: Comparing Apocytochrome f structure and function between Chara vulgaris (a charophyte alga) and land plants could reveal adaptations that facilitated the transition to terrestrial environments .

  • Ecological adaptations: As Chara vulgaris inhabits diverse freshwater environments, comparing populations from different habitats might reveal adaptations in photosynthetic proteins that enhance fitness under specific conditions .

  • Stress response mechanisms: Investigations into whether the dual role of cytochrome f in electron transport and stress signaling is conserved across photosynthetic lineages could provide insights into the evolution of cellular stress responses .

What emerging technologies might enhance Apocytochrome f research?

Emerging technologies that could advance this research field include:

  • Cryo-electron microscopy for high-resolution structural analysis

  • Live-cell imaging techniques to track protein movement in real-time

  • CRISPR-Cas9 gene editing to create modified versions in native organisms

  • Advanced mass spectrometry for post-translational modification analysis

  • Computational modeling of electron transfer dynamics

These approaches could provide unprecedented insights into both the structure and function of this important photosynthetic protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.