Recombinant Chara vulgaris ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

1. Overview of Recombinant Chara vulgaris ATP Synthase Subunit a, Chloroplastic (atpI)

Recombinant Chara vulgaris ATP synthase subunit a, chloroplastic (atpI), is a membrane-embedded protein component of the ATP synthase complex, critical for proton translocation and ATP synthesis in chloroplasts. This recombinant variant is engineered with an N-terminal His tag for purification and research applications. It is expressed in Escherichia coli and retains functional properties for structural and biochemical studies .

3. Production and Purification Methods

Expression System

  • Codon-optimized gene inserted into E. coli vectors for soluble expression .

  • Fusion tags (e.g., His tag) enable affinity chromatography purification .

Purification Protocol

  1. Cell Lysis: Sonication in Tris-based buffer.

  2. Affinity Chromatography: Ni-NTA resin for His-tag isolation.

  3. Buffer Exchange: Stabilization in glycerol-containing storage buffers .

Role in ATP Synthase Assembly

  • Bacterial AtpI stabilizes the F₀ rotor (c-ring) and enhances F₁ domain membrane association .

  • Deletion of atpI reduces ATPase activity by 30% and proton-pumping efficiency by 50% in Bacillus pseudofirmus .

Chloroplast-Specific Adaptations

  • In plants, AtpI (subunit IV) is part of the CF₀ subcomplex, essential for proton gradient coupling .

  • Mutations in chloroplast AtpI disrupt ATP synthase stoichiometry and photosynthetic efficiency .

5. Research Applications

Current Uses

  • Structural Biology: Crystallization studies to map proton translocation pathways .

  • Functional Assays: Measuring ATP hydrolysis and proton-pumping activities .

  • Biotechnological Engineering: Optimizing ATP synthase efficiency in synthetic systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
atpI
Target Protein Sequence
MYNLCYIQNLLEYQIAAVEVGQHLYWEIGNFEVHAQVLITSWIVIGLILGLTFLATQNLQ FIPTQNQNLIEYILEFIRDLTKSQIGESEYRPWIPFIGTMFLFIFVSNWSGALIPFKLVQ LPNGELAAPTNDINTTVALALLTSVAYFYAGLRKKGLSYFGKYIKPTPILLPINILEDFT KPLSLSFRLFGNILADELVVAVLVSLVPLVVPIPMMFLGLFTSAIQALIFATLAAAYIGE SIEDHH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel, playing a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural role of ATP synthase subunit a (atpI) in the chloroplast ATP synthase complex?

ATP synthase subunit a (also referred to as subunit IV in some literature) is an essential component of the membrane-integral CFo subcomplex of chloroplast ATP synthase. It functions as part of the proton channel that facilitates H+ translocation across the thylakoid membrane. The subunit a is encoded by the plastid gene atpI and works in concert with other CFo subunits (b, b', and c) to form the complete proton-conducting pathway .

How does the Chara vulgaris ATP synthase subunit a differ from those in other photosynthetic organisms?

While the search results don't specifically address Chara vulgaris ATP synthase differences, research indicates that the subunit composition of chloroplast ATP synthase has remained remarkably consistent throughout the evolution of the green lineage. All photosynthetic organisms from cyanobacteria to green algae and land plants possess the same 9 subunits with similar stoichiometry (α3β3γδεabb'c13–15) .

The conservation of ATP synthase structure suggests that Chara vulgaris subunit a likely maintains the fundamental structure and function found across green lineage organisms, though species-specific differences may exist in amino acid sequences that could affect protein-protein interactions, regulation, or specific adaptations to Chara's aquatic habitat.

What is the genetic organization of the atpI gene in chloroplasts and how is it expressed?

In land plants, the atpI gene is arranged with other ATP synthase genes (atpH/F/A) in an operon structure within the plastid genome. This organization differs from that in green algae like Chlamydomonas, where the genes are distributed across the chloroplast chromosome .

The expression of atpI involves several nuclear-encoded factors. In Arabidopsis, proteins like PPR10 are essential for the stability of processed atpI-atpH transcripts by binding to intergenic regions and protecting them from exoribonucleases. ATP1 and ATP4 are also implicated in atpH/F mRNA accumulation and stability .

In Chlamydomonas, MTHI1 (an octotricopeptide repeat protein) is specifically involved in atpI mRNA translation, highlighting different regulatory mechanisms between land plants and green algae .

What are the most effective methods for recombinant expression of Chara vulgaris ATP synthase subunit a?

For recombinant expression of chloroplast ATP synthase components, researchers typically employ the following approaches:

  • Heterologous Expression Systems: For plastid-encoded proteins like subunit a, E. coli expression systems have been used, though membrane protein expression often presents challenges due to toxicity and proper folding issues.

  • Optimization Strategies:

    • Using low-copy number plasmids and weak promoters to control expression levels

    • Fusion with solubility-enhancing tags (MBP, SUMO, etc.)

    • Co-expression with chaperones to assist proper folding

    • Addition of N-terminal signal sequences for membrane targeting

  • Membrane Protein-Specific Approaches:

    • Expression in specialized E. coli strains (C41/C43) designed for membrane proteins

    • Cell-free expression systems supplemented with liposomes or nanodiscs

    • Use of mild detergents for extraction and purification

  • Validation of Functionality: After purification, verification of proper folding and function through circular dichroism spectroscopy, limited proteolysis, and reconstitution into liposomes for proton translocation assays.

What purification and characterization techniques are most suitable for studying recombinant ATP synthase subunit a?

Purification and characterization of recombinant ATP synthase subunit a requires specialized approaches for membrane proteins:

  • Extraction and Solubilization:

    • Gentle detergents (DDM, LMNG, or digitonin) maintain protein structure

    • Sequential extraction to separate membrane proteins based on detergent solubility

  • Purification Methods:

    • Immobilized metal affinity chromatography (IMAC) using histidine tags

    • Size exclusion chromatography to remove aggregates and detergent micelles

    • Ion exchange chromatography for further purification

  • Structural Characterization:

    • Cryo-electron microscopy for structural analysis

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Functional Assessment:

    • Reconstitution into liposomes for proton pumping assays

    • Patch-clamp electrophysiology for channel activity

    • Proton gradient-dependent ATP synthesis in reconstituted systems

How can researchers effectively study protein-protein interactions involving ATP synthase subunit a?

Several complementary methods can be employed to study protein-protein interactions of ATP synthase subunit a:

  • In vivo Approaches:

    • Split-ubiquitin yeast two-hybrid specifically designed for membrane proteins

    • Bimolecular Fluorescence Complementation (BiFC) in chloroplasts

    • Förster Resonance Energy Transfer (FRET) with fluorescently tagged proteins

  • Biochemical Methods:

    • Co-immunoprecipitation with antibodies against subunit a or potential interactors

    • Chemical cross-linking followed by mass spectrometry (CLMS)

    • Blue native PAGE to preserve native interactions within the complex

  • Structural Biology:

    • Cryo-EM of the intact ATP synthase complex

    • X-ray crystallography of subcomplexes containing subunit a

    • NMR spectroscopy for dynamic interactions

  • Computational Prediction:

    • Molecular docking using available structural information

    • Coevolution analysis to identify co-evolving residues between interacting proteins

The integration of these approaches has been successful in identifying factors like BFA1, BFA3, and CGL160 that interact with ATP synthase subunits during assembly .

How does post-translational regulation affect the function of ATP synthase subunit a in Chara vulgaris?

The post-translational regulation of ATP synthase subunit a likely involves several mechanisms:

  • Integration into Thylakoid Membranes: For chloroplast-encoded proteins like subunit a, membrane integration occurs post-translationally, as demonstrated in studies with other organisms. This process may involve specific targeting pathways, although the exact mechanisms remain poorly understood for subunit a .

  • Regulation by Redox State: The chloroplast ATP synthase activity is regulated by the redox state of the chloroplast through thioredoxin-mediated disulfide-dithiol interchanges. While the γ subunit contains the regulatory disulfide bridge in the CF1 portion, redox changes could indirectly affect subunit a function through conformational changes in the complex.

  • Assembly-Dependent Stability: Research has shown that unassembled ATP synthase subunits undergo rapid degradation. The stability and function of subunit a likely depend on proper assembly with other CFo components, mediated by assembly factors like CGL160 .

  • Proton Motive Force Regulation: The activity of the entire ATP synthase complex, including subunit a, is regulated by the proton motive force generated across the thylakoid membrane during photosynthesis.

What are the critical residues in ATP synthase subunit a that determine proton translocation efficiency?

While the search results don't provide specific information about critical residues in Chara vulgaris ATP synthase subunit a, research in other organisms has identified key features:

  • Conserved Arginine Residue: A highly conserved arginine in subunit a is essential for proton translocation. This residue is thought to form part of the proton pathway and interact with the c-ring during rotation.

  • Half-Channels Structure: Subunit a forms two half-channels that allow protons to access the c-ring from opposite sides of the membrane. Specific amino acids line these channels and are critical for proton transfer.

  • Interface with c-ring: Residues at the interface between subunit a and the c-ring are crucial for defining the rotation mechanism and preventing proton leakage.

  • Lipid-Interacting Residues: Specific residues interact with membrane lipids, which can affect the orientation and stability of the subunit in the membrane.

How do environmental factors affect the expression and assembly of ATP synthase subunit a in Chara vulgaris?

Environmental factors likely influence ATP synthase subunit a expression and assembly through several mechanisms:

  • Light Intensity: As a photosynthetic organism, Chara vulgaris modulates ATP synthase expression in response to light conditions. High light intensities may increase expression to enhance ATP production capacity, while low light may trigger adaptive responses to optimize energy capture.

  • Temperature Variation: Temperature affects membrane fluidity and protein folding, potentially influencing the integration and assembly of membrane proteins like subunit a. Temperature-dependent changes in assembly factor availability or activity may also impact ATP synthase biogenesis.

  • Nutrient Availability: Limited nutrient conditions (particularly nitrogen or phosphorus) may alter energy allocation priorities, affecting ATP synthase expression and assembly.

  • Aquatic CO2 Levels: As an aquatic charophyte, Chara vulgaris experiences variable CO2 concentrations that affect photosynthetic efficiency and consequently ATP demand, potentially influencing ATP synthase expression.

  • Salinity and pH: These factors affect membrane potential and proton gradients, which may trigger compensatory changes in ATP synthase composition or regulation.

What strategies can be employed to genetically modify the atpI gene for improved ATP synthase performance?

Several approaches can be considered for engineering the atpI gene to enhance ATP synthase performance:

  • Targeted Mutagenesis:

    • Modification of residues in the proton channel to optimize proton translocation rates

    • Engineering the interface between subunit a and the c-ring to reduce friction during rotation

    • Altering regulatory sites to modify responses to environmental signals

  • Heterologous Substitution:

    • Replacing the native atpI with versions from organisms with more efficient photosynthesis

    • Creating chimeric proteins combining advantageous features from different species

  • Optimizing Gene Expression:

    • Modifying promoter elements to enhance expression under specific conditions

    • Engineering 5' and 3' untranslated regions to improve mRNA stability and translation efficiency

    • Codon optimization to enhance translation efficiency

  • Synthetic Biology Approaches:

    • Rational design based on structure-function relationships

    • Directed evolution to select for variants with improved properties

    • Computational protein design to optimize energy landscape

These engineering strategies would need to consider the complex interactions within the ATP synthase and maintain the delicate balance required for efficient energy conversion .

What methods are most effective for studying the effects of atpI mutations on ATP synthase function?

Studying the effects of atpI mutations requires a multi-faceted approach:

  • In Vitro Analysis:

    • Recombinant expression of mutant proteins

    • Reconstitution into liposomes to measure proton pumping

    • Structural studies to determine conformational changes

    • ATP synthesis/hydrolysis assays with purified complexes

  • In Vivo Approaches:

    • Chloroplast transformation to introduce mutations in the native context

    • Complementation studies in knockout/knockdown lines

    • Measurement of photosynthetic parameters (NPQ, ETR, pmf)

    • Growth and fitness assessments under varying conditions

  • Biophysical Characterization:

    • Patch-clamp electrophysiology to measure proton conductance

    • Electrochromic shift measurements to assess pmf utilization

    • FRET-based sensors to detect conformational changes in assembled complexes

  • Systems Biology:

    • Transcriptomics and proteomics to identify compensatory responses

    • Metabolomics to assess impacts on energy metabolism

    • Mathematical modeling to predict effects on photosynthetic efficiency

The integration of these approaches provides a comprehensive understanding of how specific mutations affect the function of ATP synthase at molecular, cellular, and organismal levels.

What are the potential applications of engineered Chara vulgaris ATP synthase subunit a in bioenergetics research?

Engineered Chara vulgaris ATP synthase subunit a could contribute to bioenergetics research in several ways:

  • Improved Photosynthetic Efficiency:

    • Optimized ATP synthase could enhance the energy conversion efficiency in photosynthetic organisms

    • Engineering proton translocation properties might reduce energy losses in the ATP synthesis process

  • Biomimetic Energy Conversion Systems:

    • Engineered ATP synthase components could serve as blueprints for artificial molecular motors

    • Integration into synthetic membranes for ATP production in cell-free systems

  • Stress Tolerance Enhancement:

    • Variants with improved stability under temperature extremes or pH fluctuations

    • Modified regulatory properties to maintain ATP production under stress conditions

  • Fundamental Research Tools:

    • Structure-function studies using engineered variants

    • Investigation of evolutionary adaptations in ATP synthase components

    • Probing the limits of biological energy conversion efficiency

  • Bioremediation Applications:

    • Engineered algal systems with enhanced ATP production for wastewater treatment

    • Carbon sequestration technologies utilizing optimized photosynthetic efficiency

These applications align with current research directions in chloroplast ATP synthase engineering, which focuses on modulating photosynthesis for enhanced productivity under stress conditions .

How does the ATP synthase subunit a from Chara vulgaris compare with those from other photosynthetic organisms?

The ATP synthase subunit a from Chara vulgaris likely shares fundamental structural and functional characteristics with its counterparts in other photosynthetic organisms, reflecting the conserved nature of this essential complex. A comparative analysis reveals:

  • Evolutionary Conservation:

    • The subunit composition of chloroplast ATP synthase has remained remarkably consistent throughout the evolution of the green lineage, including cyanobacteria, green algae, and land plants

    • All these organisms possess 9 subunits in the stoichiometry of α3β3γδεabb'c13–15, forming a multi-protein complex of approximately 540 kDa

  • Structural Adaptations:

    • Charophytes like Chara represent an evolutionary lineage between green algae and land plants

    • Their ATP synthase may reflect intermediate characteristics in terms of regulatory mechanisms and environmental adaptations

  • Genetic Organization:

    • The organization of ATP synthase genes differs between green algae (distributed across the chloroplast chromosome) and land plants (arranged in operons)

    • As a charophyte, Chara vulgaris may exhibit an intermediate gene organization pattern reflecting its evolutionary position

  • Regulatory Mechanisms:

    • Green algae like Chlamydomonas employ octotricopeptide repeat (OPR) proteins for post-transcriptional regulation

    • Land plants predominantly use pentatricopeptide repeat (PPR) proteins

    • Chara may utilize aspects of both regulatory systems or possess unique adaptations

This comparative framework provides valuable insights into the evolutionary trajectory of ATP synthase and can inform research on structure-function relationships and adaptive strategies.

What methodological approaches are most effective for conducting phylogenetic analyses of ATP synthase components?

Effective phylogenetic analysis of ATP synthase components requires a comprehensive methodological toolkit:

  • Sequence Acquisition and Processing:

    • Extraction of atpI sequences from complete chloroplast genomes

    • Inclusion of diverse taxonomic representatives spanning the green lineage

    • Careful alignment using algorithms optimized for membrane proteins

    • Selection of appropriate evolutionary models based on protein characteristics

  • Tree Construction Methods:

    • Maximum Likelihood for robust statistical inference

    • Bayesian approaches to estimate confidence in branching patterns

    • Parsimony methods as complementary analyses

    • Distance-based methods for initial exploration

  • Validation Approaches:

    • Bootstrap analysis to assess branch support

    • Likelihood ratio tests for alternative tree topologies

    • Cross-validation using independent datasets

    • Comparison with established organismal phylogenies

  • Advanced Analytical Methods:

    • Coevolution analysis between interacting subunits

    • Tests for positive selection on specific lineages or sites

    • Analysis of indels as phylogenetic characters

    • Ancestral sequence reconstruction

  • Integrative Approaches:

    • Combining sequence data with structural information

    • Incorporating functional constraints into evolutionary models

    • Contextualizing ATP synthase evolution with habitat and physiological adaptations

These approaches have been applied to study ATP synthase evolution, such as in the identification of the γ2 subunit resulting from an ancient gene duplication in mosses and dicots .

What are the common challenges in expressing and purifying recombinant Chara vulgaris ATP synthase subunit a, and how can they be overcome?

Researchers face several challenges when working with recombinant ATP synthase subunit a, with specific solutions for each issue:

  • Toxicity to Expression Hosts:

    • Challenge: Membrane protein overexpression often disrupts host cell membrane integrity

    • Solutions:

      • Use tightly regulated expression systems (like pET with T7 lysozyme)

      • Lower induction temperature (16-20°C)

      • Reduce inducer concentration

      • Use specialized strains (C41/C43) designed for toxic membrane proteins

  • Protein Misfolding and Aggregation:

    • Challenge: Hydrophobic membrane proteins tend to aggregate during expression

    • Solutions:

      • Co-express with molecular chaperones (GroEL/ES, DnaK)

      • Include membrane-mimetic environments during purification

      • Use fusion partners that enhance solubility (MBP, SUMO)

      • Add mild detergents during cell lysis

  • Low Yield:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solutions:

      • Scale up culture volume

      • Optimize codon usage for the expression host

      • Use stronger promoters with tight regulation

      • Implement fed-batch fermentation

      • Consider cell-free expression systems

  • Difficult Extraction and Purification:

    • Challenge: Efficient extraction from membranes without denaturation

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, digitonin)

      • Use styrene-maleic acid lipid particles (SMALPs) for native membrane extraction

      • Implement two-phase aqueous polymer systems

      • Gradual detergent exchange during purification

  • Functional Assessment Limitations:

    • Challenge: Verifying proper folding and function of isolated subunit a

    • Solutions:

      • Reconstitution with other ATP synthase components

      • Develop specific activity assays for subunit a function

      • Use structural probes (limited proteolysis, fluorescence)

      • Implement complementation assays in mutant systems

How should experiments be designed to investigate the specific role of subunit a in proton translocation?

Designing experiments to investigate subunit a's role in proton translocation requires multiple complementary approaches:

  • Site-Directed Mutagenesis Strategy:

    • Target conserved residues predicted to form the proton pathway

    • Create systematic alanine scanning libraries of transmembrane segments

    • Generate conservative substitutions to distinguish between structural and functional roles

    • Design cysteine mutations for accessibility studies

  • Functional Assays:

    • In vitro proton pumping: Reconstitute purified ATP synthase with fluorescent pH indicators

    • Patch-clamp electrophysiology: Measure proton currents through individual ATP synthase complexes

    • ATP synthesis assays: Quantify ATP production rates with mutated subunit a variants

    • Proton leak measurements: Assess the integrity of the proton pathway

  • Structural Analysis:

    • Cryo-EM studies of ATP synthase with wild-type and mutant subunit a

    • Cross-linking studies to capture different conformational states

    • Molecular dynamics simulations of proton movement through subunit a

    • Hydrogen-deuterium exchange to identify solvent-accessible regions

  • Real-time Dynamics:

    • FRET-based sensors to detect conformational changes during catalysis

    • Single-molecule studies of ATP synthase rotation

    • Time-resolved spectroscopy to follow proton movement

    • High-speed atomic force microscopy to visualize conformational changes

  • Experimental Controls:

    • Positive controls: Known functional mutations in other organisms

    • Negative controls: Mutations in non-channel regions

    • System controls: Uncouplers to collapse proton gradients

    • Technical validations: Multiple measurement techniques for each parameter

The integration of these approaches can provide a comprehensive understanding of how specific residues and structural elements in subunit a contribute to proton translocation.

How can researchers validate the functionality of recombinant ATP synthase subunit a before integration studies?

Validating the functionality of recombinant ATP synthase subunit a requires multiple independent approaches:

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Tryptophan fluorescence to assess tertiary folding

    • Limited proteolysis to probe for proper folding

    • Size exclusion chromatography to verify monodispersity

  • Membrane Integration Analysis:

    • Flotation assays in density gradients with liposomes

    • Protease protection assays to verify proper topology

    • Fluorescence quenching to assess membrane insertion

    • EPR spectroscopy with spin-labeled variants to determine membrane positioning

  • Interaction Studies:

    • Pull-down assays with other ATP synthase subunits

    • Native PAGE to assess complex formation

    • Surface plasmon resonance to quantify binding affinities

    • Co-reconstitution with labeled partner proteins

  • Preliminary Functional Testing:

    • Proton permeability assays in reconstituted liposomes

    • Complementation of subunit a-deficient bacterial strains

    • Partial reactions such as ATP-driven proton pumping

    • Monitoring of conformational changes using environmentally sensitive probes

These validation steps ensure that the recombinant protein maintains native-like properties before proceeding to more complex integration and functional studies.

What statistical approaches are most appropriate for analyzing ATP synthase activity data?

  • Experimental Design Considerations:

    • Power analysis to determine appropriate sample sizes

    • Randomized block design to control for batch effects

    • Factorial designs to test multiple variables simultaneously

    • Latin square designs for complex multi-factor experiments

  • Data Quality Assessment:

    • Tests for normality (Shapiro-Wilk, Q-Q plots)

    • Homogeneity of variance tests (Levene's, Bartlett's)

    • Outlier detection methods (Grubbs' test, Dixon's Q test)

    • Transformations when needed (log, Box-Cox)

  • Statistical Methods for Comparison:

    • t-tests for simple two-group comparisons

    • ANOVA with appropriate post-hoc tests for multiple groups

    • Non-parametric alternatives when assumptions are violated

    • Mixed-effects models for repeated measures and nested designs

  • Regression and Correlation Analysis:

    • Linear or non-linear regression for dose-response relationships

    • Multiple regression for complex factor interactions

    • Correlation analysis to identify related parameters

    • Path analysis for causal relationships

  • Advanced Statistical Approaches:

    • Principal component analysis for multivariate data

    • Cluster analysis to identify patterns in complex datasets

    • Bayesian inference for integrating prior knowledge

    • Machine learning for pattern recognition in large datasets

These statistical approaches ensure robust interpretation of experimental data and facilitate comparison between different ATP synthase variants or experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.