Recombinant Chara vulgaris ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
atpF
Target Protein Sequence
MSEIIHVINPMSKWPLASQFGFNLDILETNLINLGVVIGTLLYFGNEVISNLLNKRKEII LNSIRDAEQRYEDATEKLKQANRDLEKAKFKANEIRIQGSTQIEIEKKELIYAADRDSKH LEESKNIAIHLEEQRILEEVRREVSGLAFQKTLIILNNRLTSQLQVEMIDYKIDLFFNNF QVSTNL
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-embedded proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F(0) channel and part of the peripheral stalk, linking F(1) and F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the chloroplastic ATP synthase subunit b (atpF) and what role does it play in the ATP synthase complex?

The chloroplastic ATP synthase subunit b (atpF) is a key component of the F₀ sector of the chloroplast ATP synthase (CF₀CF₁) complex. It forms part of the peripheral stalk (stator) that connects the membrane-embedded F₀ portion to the catalytic F₁ portion. This peripheral stalk is crucial for holding the α₃β₃ catalytic domain stationary during the rotary motion of the central stalk, which drives ATP synthesis. Structurally, the hallmark feature of the F₀ subunit b is an extended helix that spans the distance between the membrane and the α₃β₃ catalytic core . This structural arrangement is essential for transmitting the proton motive force to the catalytic sites while preventing the entire complex from spinning uselessly in the membrane.

How does atpF in Chara vulgaris compare to homologous proteins in other photosynthetic organisms?

While specific sequence comparisons for Chara vulgaris atpF are not detailed in the provided literature, research on other photosynthetic organisms shows that F₀ sector subunits (including subunit b) can exhibit considerable sequence divergence across species while maintaining structural and functional conservation. For example, even in cases of "extreme sequence diversification," key structural features remain conserved to maintain function . In algal species like Chlamydomonas reinhardtii (which has been used as a model organism for photosynthesis studies), these proteins retain their critical structural elements despite sequence variations . The conservation of extended helical domains and specific interaction sites would be expected in Chara vulgaris atpF as well, given the fundamental importance of these features to ATP synthase function across all photosynthetic organisms.

Why is the recombinant expression of atpF particularly challenging compared to other ATP synthase subunits?

Recombinant expression of membrane-associated proteins like atpF presents several specific challenges. The protein contains hydrophobic domains that anchor it to membranes, making it difficult to express in soluble form. Additionally, the extended helical domain of subunit b requires proper folding to maintain its functional conformation. Expression systems must be carefully selected to accommodate these structural requirements. Based on experimental approaches with other ATP synthase components, expression often requires specialized host systems, such as the unicellular green alga Chlamydomonas reinhardtii, which has been successfully used to produce recombinant ATP synthase components by introducing plasmids encoding the target proteins . The challenge is further complicated by the fact that subunit b typically functions as part of a multiprotein complex, and isolated expression may affect its stability and folding.

What expression systems are most effective for producing functional recombinant Chara vulgaris atpF protein?

For producing functional recombinant chloroplastic proteins like atpF, algal expression systems have shown particular promise. Based on the literature, Chlamydomonas reinhardtii has been successfully used as a host organism for expressing ATP synthase components . This approach leverages "the powerful genetics of Chlamydomonas reinhardtii as a model organism for photosynthesis" to facilitate the expression of properly folded and functional photosynthetic proteins .

When designing an expression system for Chara vulgaris atpF, researchers should consider:

  • Using photosynthetic organisms as expression hosts to provide the appropriate cellular environment

  • Employing endogenous promoters to ensure proper expression levels

  • Including appropriate targeting sequences for chloroplast localization

  • Considering co-expression with interacting partners to enhance stability

A methodology similar to that reported for other chloroplast proteins could be employed, where plasmids encoding the target protein (with appropriate tags for purification) are introduced into the host organism, followed by selection and verification of transformants .

How can mutagenesis studies of recombinant atpF help elucidate the redox regulation mechanism of chloroplast ATP synthase?

A comprehensive mutagenesis approach should:

  • Target the regions of atpF that potentially interact with redox-sensitive components

  • Focus on amino acid residues involved in the peripheral stalk structure

  • Examine how mutations affect the transmission of conformational changes from the F₀ to F₁ sector

For example, researchers investigating the redox regulation of ATP synthase have used site-directed mutagenesis to modify specific amino acid sequences, such as the DDE motif (a cluster of negatively charged amino acids), followed by biochemical analysis to determine how these changes affect enzyme function under varying redox conditions . Similar approaches could be applied to atpF to understand its role in the redox regulation machinery.

What purification strategies yield the highest purity and activity for recombinant Chara vulgaris atpF protein?

Purification of membrane proteins like atpF requires specialized approaches. Based on successful methodologies for ATP synthase components, a multi-step purification strategy is recommended:

  • Initial Extraction and Solubilization: Use mild detergents that maintain protein structure while extracting from membranes. Common detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin, which have been effective for ATP synthase components .

  • Affinity Purification: Incorporate affinity tags (such as YFP-HA tags) into the recombinant protein design to facilitate specific binding to affinity resins. This approach has been successfully used for ATP synthase subunits .

  • Size-exclusion Chromatography: Apply size-based separation to isolate the properly folded protein from aggregates and contaminants.

  • Blue Native Polyacrylamide Gel Electrophoresis (BNP): This technique has proven valuable for analyzing intact ATP synthase complexes and could be adapted for verification of purified components .

For optimal results, researchers should verify purification success through both activity assays and structural integrity checks. For instance, studies on ATP synthase have confirmed proper folding and activity by assessing ATP synthesis capability in the presence/absence of inhibitors . Similar functional assays would be valuable for verifying the quality of purified recombinant atpF.

How can researchers differentiate between functional and non-functional recombinant atpF in their experimental systems?

Differentiation between functional and non-functional recombinant atpF requires multiple analytical approaches:

  • Structural Integrity Analysis:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content, particularly the expected high alpha-helical content of atpF

    • Limited proteolysis patterns to confirm proper folding

    • Size-exclusion chromatography profiles to detect aggregation

  • Interaction Studies:

    • Co-immunoprecipitation with known binding partners such as other peripheral stalk components

    • Crosslinking studies to verify correct positioning within the ATP synthase complex

    • Blue Native PAGE analysis to assess incorporation into higher-order complexes

  • Functional Complementation:

    • Introduction of recombinant atpF into systems with deleted or mutated endogenous atpF

    • Assessment of ATP synthesis capability restoration

    • Measurement of proton translocation coupling efficiency

Researchers have successfully used such approaches to verify the functionality of ATP synthase components. For example, in studies of the T. gondii ATP synthase, researchers confirmed proper function by demonstrating that tagged versions of ATP synthase subunits maintained cellular ATP levels via oxidative phosphorylation in the absence of glucose, which could be inhibited by atovaquone . Similar assays would be valuable for Chara vulgaris atpF.

What spectroscopic techniques are most informative for studying the structural dynamics of atpF in different redox states?

Several spectroscopic techniques provide valuable insights into the structural dynamics of ATP synthase components like atpF under different redox conditions:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Allows measurement of distance changes between strategic points in the protein

    • Can be used to monitor conformational changes in real-time as redox conditions change

    • Requires strategic placement of fluorophores at non-disruptive positions

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • When combined with site-directed spin labeling, can detect subtle conformational changes

    • Particularly valuable for monitoring changes in the proximity of specific residues

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides information about solvent accessibility changes in different redox states

    • Can identify regions that undergo conformational changes without requiring protein modification

  • Fourier-Transform Infrared (FTIR) Spectroscopy:

    • Useful for monitoring secondary structure changes in response to redox modifications

    • Can be performed under physiologically relevant conditions

These techniques have been valuable in understanding the redox-dependent conformational changes in ATP synthase components. For example, studies of the chloroplast ATP synthase have revealed that the redox state of regulatory cysteine residues influences the conformation of the γ subunit, which in turn affects rotation during catalysis . Similar approaches would be informative for understanding how atpF responds to changes in the redox environment.

How should researchers interpret contradictory data regarding atpF function in ATP synthesis versus ATP hydrolysis assays?

Contradictory results between ATP synthesis and hydrolysis assays are common when studying ATP synthase components and require careful interpretation:

  • Direction-Dependent Effects:

    • ATP synthase is not simply reversible; certain regulatory mechanisms may specifically affect synthesis or hydrolysis

    • The redox regulation of chloroplast ATP synthase predominantly affects ATP hydrolysis while having less impact on synthesis under certain conditions

  • Experimental Condition Considerations:

    • pH differences between synthesis and hydrolysis assays can affect protein conformation

    • Detergent choice for protein solubilization may differently impact forward versus reverse reactions

    • Presence of other cellular components may regulate directionality

  • Resolution Approaches:

    • Conduct assays under identical buffer conditions where possible

    • Use reconstituted systems to control component composition

    • Perform detailed kinetic analyses to identify specific steps affected

When interpreting contradictory data, researchers should consider that ATP synthase has evolved regulatory mechanisms specifically to prevent wasteful ATP hydrolysis in the dark while allowing synthesis in the light . The peripheral stalk, including atpF, plays a crucial role in this regulation by transmitting conformational changes between F₀ and F₁ sectors. Therefore, atpF mutations might differentially affect synthesis versus hydrolysis activities depending on how they impact this regulatory transmission.

What are the optimal conditions for measuring atpF-dependent ATP synthesis activity in reconstituted systems?

The optimal conditions for measuring atpF-dependent ATP synthesis in reconstituted systems should simulate the physiological environment of chloroplasts while allowing precise control of experimental variables:

  • Buffer Components:

    • pH 7.8-8.2 (typical stromal pH during illumination)

    • 2-5 mM Mg²⁺ (critical cofactor for ATP synthesis)

    • 10-50 mM KCl (for ionic strength)

    • Redox buffer (typically DTT for reduced conditions)

  • Membrane Reconstitution:

    • Liposomes composed of 70-80% phosphatidylcholine and 20-30% phosphatidic acid

    • Protein:lipid ratio of 1:50 to 1:100 by weight

    • Gentle detergent removal using Bio-Beads or dialysis

  • Energization Methods:

    • Acid-base transition (to generate ΔpH)

    • Valinomycin with K⁺ gradient (to generate Δψ)

    • Combined approach to maximize proton motive force

  • Measurement Parameters:

    • Temperature: 25-30°C

    • ADP concentration: 0.2-1.0 mM

    • P<sub>i</sub> concentration: 5-10 mM

    • Luciferase-based ATP detection system for real-time monitoring

  • Controls:

    • Uncoupler controls (FCCP or nigericin+valinomycin) to confirm ΔpH dependence

    • Inhibitor controls (oligomycin for F₀, efrapeptin for F₁)

    • System without reconstituted protein

The reconstitution approach should be similar to methods used for other ATP synthase components, where researchers have successfully measured activity by tracking ATP production under controlled energization conditions .

What techniques can effectively determine the stoichiometry of atpF within the complete chloroplast ATP synthase complex?

Determining the precise stoichiometry of atpF within the chloroplast ATP synthase complex requires complementary analytical approaches:

  • Quantitative Mass Spectrometry:

    • Stable isotope labeling with amino acids in cell culture (SILAC)

    • Absolute quantification (AQUA) using synthetic labeled peptides

    • Intensity-based absolute quantification (iBAQ)

  • Single-Molecule Fluorescence:

    • Photobleaching step analysis of fluorescently labeled subunits

    • Single-molecule pull-down (SiMPull) assays

    • Direct visualization of labeled complexes

  • Biochemical Approaches:

    • Quantitative Western blotting with purified standards

    • Radioactive labeling and scintillation counting

    • Densitometry analysis of stained gel bands

  • Structural Methods:

    • Cryo-electron microscopy (cryo-EM) reconstruction

    • X-ray crystallography density analysis

    • Cross-linking mass spectrometry

This multi-technique approach is essential because individual methods have inherent limitations. For example, mass spectrometry analysis has been successfully used to identify novel subunits of ATP synthase complexes , but quantitative determination of stoichiometry often requires additional validation. Studies on the T. gondii F-type ATP synthase used mass spectrometry analysis of partially purified monomeric (~600 kDa) and dimeric (>1 MDa) forms of the enzyme to identify subunit composition , and similar approaches would be valuable for determining atpF stoichiometry in the Chara vulgaris ATP synthase complex.

How can researchers effectively design chimeric constructs to investigate domain-specific functions of atpF?

Designing effective chimeric constructs for investigating domain-specific functions of atpF requires strategic planning based on structural and functional knowledge:

  • Domain Mapping:

    • Transmembrane domain (typically N-terminal)

    • Extended helical domain (forming the peripheral stalk)

    • Interaction domains with other subunits

    • Species-specific regions versus conserved regions

  • Junction Design Principles:

    • Place junctions in naturally flexible regions

    • Maintain secondary structure elements intact

    • Consider adding short glycine-serine linkers at domain boundaries

    • Ensure transmembrane segments remain properly positioned

  • Chimera Types to Consider:

    • Species hybrids (e.g., Chara vulgaris/Chlamydomonas reinhardtii)

    • Homologous protein chimeras (e.g., atpF/atpG)

    • Reporter construct fusions for localization studies

  • Validation Approaches:

    • Functional complementation in knockout backgrounds

    • Co-immunoprecipitation to verify interaction partners

    • ATP synthesis/hydrolysis assays

    • In vivo localization studies

For example, researchers investigating ATP synthase components have used YFP-HA tags fused to the 3' end of genes encoding ATP synthase subunits to track localization and facilitate purification . Similar approaches could be used to create chimeric atpF constructs, with the added dimension of domain swapping between species or related proteins to isolate domain-specific functions.

How does the function of atpF in Chara vulgaris compare to its homologs in cyanobacteria and higher plants?

The function of atpF shows both conservation and adaptation across the evolutionary spectrum from cyanobacteria to green algae (like Chara vulgaris) to higher plants:

  • Structural Conservation:

    • The core function of forming part of the peripheral stalk is conserved across all photosynthetic organisms

    • The extended helical domain remains a hallmark feature from cyanobacteria to higher plants

  • Regulatory Adaptations:

    • Chloroplast ATP synthases (including those in Chara and higher plants) feature redox regulation machinery not present in cyanobacteria

    • This regulation involves coordination between peripheral stalk components (including atpF) and the γ subunit containing regulatory cysteines

  • Interaction Differences:

    • While the basic architecture is conserved, specific interaction interfaces with other subunits show greater divergence

    • Higher plants typically have more auxiliary subunits interacting with the peripheral stalk compared to cyanobacteria

  • Environmental Response:

    • The regulation mechanisms in Chara likely represent an intermediate evolutionary stage between cyanobacteria and higher plants

    • These differences reflect adaptation to different light environments and metabolic demands

The chloroplast ATP synthase's characteristic redox regulation machinery represents a significant evolutionary adaptation not found in bacterial homologs . This regulation is critical for chloroplast energy efficiency, preventing wasteful ATP hydrolysis in the dark while allowing ATP synthesis in the light. The peripheral stalk, including atpF, plays a key role in transmitting these regulatory signals within the complex.

What insights do sequence alignments and phylogenetic analyses provide about the evolution of atpF in charophyte green algae?

Sequence alignments and phylogenetic analyses of atpF across charophyte green algae and related groups reveal several important evolutionary patterns:

  • Conserved Domains:

    • The membrane-spanning regions show higher conservation than peripheral regions

    • Specific interaction sites for other peripheral stalk components maintain higher sequence identity

    • The extended helical domain exhibits conservation of physical properties (hydrophobicity, charge distribution) despite variable sequence

  • Evolutionary Trajectory:

    • Charophyte green algae (including Chara) represent an evolutionary bridge between aquatic algae and land plants

    • Their atpF sequences often show intermediate characteristics, with some features shared with chlorophytes and others with embryophytes

    • This position makes them valuable for understanding the adaptation of the photosynthetic apparatus during land plant evolution

  • Coevolution Patterns:

    • Correlated mutation analyses show coevolution between atpF and its interaction partners

    • These patterns reflect the maintenance of critical structural interfaces despite sequence divergence

  • Selection Pressures:

    • Different domains of atpF show variable rates of evolution, reflecting different functional constraints

    • Transmembrane regions typically evolve more slowly than exposed regions

While extensive sequence diversification has been observed in ATP synthase subunits across species, they maintain conserved structural features essential for function . This pattern of "sequence divergence with structural conservation" is characteristic of many ATP synthase components and would be expected in atpF as well.

How do structural modifications of atpF contribute to the adaptation of ATP synthase function in different environmental conditions?

Structural modifications of atpF across species reflect adaptations to diverse environmental conditions:

  • Temperature Adaptation:

    • Species from extreme environments show modifications in the flexibility and stability of the peripheral stalk

    • These adaptations help maintain ATP synthase function across different thermal ranges

    • In cold-adapted species, increased flexibility in certain domains may compensate for reduced molecular motion

  • Light Regime Adaptations:

    • The peripheral stalk, including atpF, plays a role in the regulatory mechanisms that respond to light/dark transitions

    • Species from fluctuating light environments show enhanced regulatory features

    • These include strategically positioned amino acids that influence the transmission of conformational changes

  • pH and Ion Concentration Responses:

    • Surface charge distribution on atpF varies across species from different ionic environments

    • These modifications help maintain protein-protein interactions under different pH conditions

    • Strategically placed histidine residues may serve as pH sensors in some species

  • Stress Response Mechanisms:

    • Some species show additional regulatory sites in atpF that respond to stress conditions

    • These may include oxidative stress response elements or phosphorylation sites

    • Such modifications allow fine-tuning of ATP synthase activity under stress conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.