Recombinant Chara vulgaris Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
petD
Target Protein Sequence
MGVTKKPDLTDPILRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACTIGLAVLDPS MIGEPANPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMASVPVGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVAIWLGIGAALPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does subunit 4 (petD) play?

The cytochrome b6f complex (Cyt b6f) is a fundamental component of photosynthetic electron transport, playing pivotal roles in both linear and cyclic electron transport of oxygenic photosynthesis. The complex typically contains four large subunits that organize the electron transfer chain and four small subunits unique to oxygenic photosynthesis .

How does the Chara vulgaris petD gene compare to those in land plants and other algae?

Chara vulgaris, as a member of the Charophyceae, represents an evolutionary position as a sister clade to the lineage that gave rise to land plants . The petD gene in C. vulgaris shows significant homology to land plant versions while maintaining distinctive characteristics reflecting its evolutionary position.

Comparative analysis reveals that C. vulgaris petD shares conserved domains with land plants that are essential for electron transport function, but may contain unique regulatory elements reflecting adaptation to aquatic environments. The gene structure typically includes regions encoding transmembrane domains characteristic of this membrane-embedded complex component.

While conservation exists in functional domains, the regulatory elements of petD in C. vulgaris likely reflect its position in streptophytic algae, showing some similarities to both chlorophytes and embryophytes in terms of expression and processing patterns .

What is known about the mitochondrial processing of genes in Chara vulgaris and how might this relate to petD?

Although petD is a chloroplast-encoded gene rather than mitochondrial, understanding gene processing in Chara vulgaris provides important context. Research indicates that mitochondrial mRNA processing in C. vulgaris resembles patterns seen in embryophytes (land plants) rather than chlorophyte algae .

This evolutionary position is significant as it suggests that nuclear-encoded factors controlling organellar gene expression in C. vulgaris may be more similar to those in land plants. By extension, this suggests that chloroplast gene processing, including for genes like petD, might follow patterns more similar to those in land plants than to those in chlorophyte algae. This has implications for experimental approaches when working with recombinant expression systems.

What are the optimal expression systems for producing recombinant Chara vulgaris petD protein?

The optimal expression system for recombinant C. vulgaris petD depends on research objectives. For structural studies requiring proper folding and post-translational modifications, eukaryotic expression systems are preferable.

Methodology:

  • Plant-based expression systems: Utilizing plants like Nicotiana benthamiana through Agrobacterium-mediated transformation offers advantages for membrane protein expression with proper folding and assembly.

  • Algal expression systems: Chlamydomonas reinhardtii provides a compatible environment for expression of algal photosynthetic proteins.

  • Yeast expression systems: Pichia pastoris can be effective for membrane protein production when equipped with appropriate chloroplast-targeting sequences.

For prokaryotic systems, consider:

  • E. coli-based expression with specialized strains optimized for membrane proteins

  • Codon optimization based on C. vulgaris codon usage bias

  • N-terminal fusion tags (His6, MBP) to enhance solubility while minimizing functional interference

Expression optimization table:

Expression SystemAdvantagesLimitationsRecommended Modifications
E. coli BL21(DE3)High yield, simple protocolsImproper folding, inclusion bodiesLow temperature induction (16°C), fusion to solubility tags
Pichia pastorisEukaryotic processing, high density cultureLonger optimization timeCodon optimization, inducible promoters
Tobacco plantsNative-like folding, PTMsLower yield, longer timeChloroplast targeting, transient expression
ChlamydomonasPhotosynthetic machinery presentSpecies-specific optimization neededUse of native promoters and UTRs

What experimental approaches are most effective for studying interactions between recombinant petD and other components of the cytochrome b6f complex?

Understanding protein-protein interactions within the cytochrome b6f complex requires specialized approaches for membrane protein complexes.

Methodology:

  • Co-immunoprecipitation with verification: Using antibodies against tagged petD to pull down interaction partners, followed by mass spectrometry identification.

  • Bimolecular Fluorescence Complementation (BiFC): Split fluorescent proteins fused to petD and potential interaction partners to visualize in vivo interactions.

  • Förster Resonance Energy Transfer (FRET): Measuring energy transfer between fluorescently labeled proteins to assess proximity.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking followed by digestion and MS analysis to identify interaction interfaces.

For functional interaction studies:

  • Reconstitution assays in liposomes with purified components

  • Mutagenesis of specific residues followed by functional assessment

  • Electron transport measurements with reconstituted complexes

The cytochrome b6f complex contains both large structural subunits and small subunits with regulatory functions. Studies of PetN (a small subunit) have shown that loss of this protein significantly destabilizes the complex, reducing the amount of large subunits to 20-25% of wild-type levels . Similar approaches could be applied to understand petD interactions.

How can researchers effectively analyze the effects of petD mutations on photosynthetic electron transport?

Analyzing functional impacts of petD mutations requires multiple complementary approaches.

Methodology:

  • Oxygen evolution measurements: Quantifying photosynthetic activity using oxygen electrodes, with techniques similar to those applied in PetN studies where oxygen evolution in mutants was reduced to ~30% of wild-type .

  • Chlorophyll fluorescence analysis: Measuring parameters including Fv/Fm, NPQ, and electron transport rate.

  • P700 absorbance measurements: Assessing PSI redox state and cyclic electron flow.

  • Inhibitor studies: Using specific inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone to assess complex sensitivity and function .

The researcher should consider:

  • Complementation studies expressing wild-type or mutant petD in knockout backgrounds

  • Comparison of state transitions using 77K fluorescence spectroscopy

  • Analysis of plastoquinone pool redox state in mutant vs. wild-type systems

Data from cytochrome b6f mutants indicate that both linear and cyclic electron transfer can be affected, leading to altered PSII/PSI ratios and disruptions in state transitions . Similar methodologies can be applied to petD mutant analysis.

What approaches can be used to study the evolutionary significance of Chara vulgaris petD in the context of land plant evolution?

Chara vulgaris occupies a significant position as an evolutionary sister to land plants, making its proteins valuable for understanding photosynthetic adaptation during terrestrialization.

Methodology:

  • Comparative genomics: Analyzing petD sequences across charophytes, chlorophytes, and land plants to identify conserved domains and lineage-specific adaptations.

  • Heterologous complementation: Expressing C. vulgaris petD in land plant or chlorophyte mutants to assess functional conservation.

  • Ancestral sequence reconstruction: Using phylogenetic methods to infer ancestral petD sequences at key evolutionary nodes.

  • Experimental evolution: Subjecting C. vulgaris to terrestrial-like conditions to observe adaptive changes in petD expression and function.

Investigations should consider that C. vulgaris possesses enzymatic toolkits that pre-date the divergence of Charophyceae from the clade that gave rise to land plants . These ancient streptophytic traits may provide insights into how photosynthetic machinery adapted during land colonization.

What purification strategies are most effective for isolating recombinant Chara vulgaris petD protein?

Purification of membrane proteins like petD requires specialized approaches to maintain structural integrity and function.

Methodology:

  • Membrane preparation: Gentle cell disruption followed by differential centrifugation to isolate membrane fractions.

  • Detergent solubilization screening: Systematic testing of detergents for optimal solubilization:

DetergentConcentration RangeAdvantagesLimitations
n-Dodecyl β-D-maltoside (DDM)0.5-2%Gentle, maintains complex integrityLarger micelles
Digitonin0.5-1%Preserves native interactionsCost, purity issues
Lauryl maltose neopentyl glycol (LMNG)0.01-0.1%Small micelles, stabilityHigher cost
Styrene maleic acid (SMA)2-3%Detergent-free, retains lipid environmentpH limitations
  • Affinity chromatography: Using engineered tags (His, Strep, FLAG) with appropriate elution conditions.

  • Size exclusion chromatography: Final polishing step to isolate properly assembled complexes.

  • Stability assessment: Monitoring protein stability through various buffers and storage conditions.

For functional studies, consider:

  • Reconstitution into liposomes or nanodiscs to restore native lipid environment

  • Activity assays to confirm functional integrity after purification

  • Circular dichroism to verify secondary structure preservation

How can researchers effectively analyze post-translational modifications of Chara vulgaris petD?

Post-translational modifications (PTMs) of photosynthetic proteins can significantly impact function and regulation.

Methodology:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics: Protein digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein to preserve modification relationships

    • Targeted MS approaches for specific modifications

  • Site-directed mutagenesis of potential modification sites:

    • Systematic mutation of predicted modification sites

    • Functional assessment of mutants

    • Comparison of modification patterns between recombinant and native protein

  • Modification-specific antibodies and chemical labeling:

    • Phosphorylation detection using phospho-specific antibodies

    • Redox modification analysis using differential alkylation

Common modifications to investigate include:

  • Phosphorylation events regulating complex assembly

  • Redox-sensitive cysteine modifications affecting electron transport

  • N-terminal processing and transit peptide removal

What strategies can be employed to assess the role of petD in the stability of the complete cytochrome b6f complex?

Understanding petD's contribution to complex stability requires multi-faceted approaches similar to those used in studies of other subunits like PetN .

Methodology:

  • In vitro stability assays:

    • Thermal shift assays to measure complex thermostability

    • Limited proteolysis to identify protected regions

    • Detergent resistance profiles of assembled complexes

  • Mutagenesis approaches:

    • Alanine-scanning mutagenesis of interface residues

    • Chimeric constructs with petD from different species

    • Truncation analysis to identify minimal functional domains

  • Quantitative analysis of complex assembly:

    • Blue native PAGE to assess complex formation

    • Quantitative immunoblotting for subunit stoichiometry

    • Pulse-chase experiments to track assembly kinetics

Studies of the PetN subunit have demonstrated that loss of even small subunits can significantly destabilize the complex, reducing large subunit levels to 20-25% of wild-type levels . Similar quantitative approaches can determine petD's contribution to complex stability.

How can structural studies of Chara vulgaris cytochrome b6f complex advance our understanding of photosynthetic evolution?

Structural analysis of C. vulgaris cytochrome b6f provides a window into evolutionary adaptations of photosynthetic machinery.

Methodology:

  • Cryo-electron microscopy: High-resolution structural determination of the assembled complex.

  • X-ray crystallography: Crystallization of the complex or individual subunits for atomic resolution.

  • Comparative structural analysis: Detailed comparison with structures from chlorophytes and land plants.

  • Molecular dynamics simulations: In silico analysis of structural dynamics and subunit interactions.

Research should focus on:

  • Unique structural features of C. vulgaris complex versus land plant counterparts

  • Conservation patterns in electron transfer pathways

  • Structural basis for adaptations to aquatic environments

  • Evolutionary changes in subunit interfaces and assembly mechanisms

The evolutionary position of Chara as a sister clade to land plants makes these structural insights particularly valuable for understanding photosynthetic adaptations during terrestrialization.

What insights can transgenic expression of Chara vulgaris petD in land plants provide about photosynthetic optimization?

Heterologous expression experiments can reveal functional conservation and adaptation potential.

Methodology:

  • Complementation studies in Arabidopsis or tobacco petD mutants:

    • Assessment of growth and photosynthetic parameters

    • Analysis of complex assembly and stability

    • Measurement of electron transport efficiency

  • Directed evolution approaches:

    • Creation of petD variant libraries

    • Selection under various stress conditions

    • Identification of adaptive mutations

  • Chimeric protein construction:

    • Domain swapping between C. vulgaris and land plant petD

    • Functional mapping of species-specific regions

    • Identification of performance-enhancing domains

Expected outcomes:

  • Identification of sequence elements conferring functional advantages

  • Understanding of evolutionary constraints on petD function

  • Potential development of photosynthetically enhanced crop plants

How might the study of Chara vulgaris petD contribute to bioenergy applications?

Fundamental research on photosynthetic components has implications for bioenergy production.

Methodology:

  • Photosynthetic efficiency engineering:

    • Identification of rate-limiting steps in electron transport

    • Targeted modification of regulatory elements

    • Assessment of biomass production under various conditions

  • Synthetic biology approaches:

    • Integration of C. vulgaris components into designer photosynthetic systems

    • Optimization of electron transport for biofuel production

    • Development of novel photosynthetic chassis organisms

  • Environmental adaptation studies:

    • Analysis of petD function under varying CO2 conditions

    • Temperature response profiling

    • Salinity and pH tolerance assessment

Research applications:

  • Enhancement of algal biofuel production systems

  • Development of stress-tolerant photosynthetic systems

  • Optimization of artificial photosynthesis components

What approaches can address low expression or insolubility of recombinant Chara vulgaris petD?

Membrane proteins like petD often present expression and solubility challenges.

Methodology:

  • Expression optimization strategies:

    • Codon optimization for expression host

    • Fusion to solubility-enhancing tags (MBP, SUMO, Trx)

    • Expression temperature and inducer concentration screening

    • Use of specialized E. coli strains (C41/C43, SHuffle)

  • Solubilization approaches:

    • Systematic detergent screening with increasing stringency

    • Amphipol or nanodisc incorporation

    • Cell-free expression systems with direct incorporation into liposomes

  • Refolding protocols:

    • Inclusion body isolation and purification

    • Controlled refolding with decreasing denaturant gradients

    • Chaperone co-expression strategies

Troubleshooting decision tree:

ProblemFirst ApproachIf UnsuccessfulAdvanced Solution
Low expressionOptimize codons, lower temperatureTry different promotersSwitch expression system
Inclusion bodiesReduce expression rateCo-express chaperonesDevelop refolding protocol
Unstable proteinScreen buffer conditionsAdd stabilizing ligandsEngineer stability mutations
Poor complex assemblyCo-express partner subunitsAdd assembly factorsUse native organism extracts

How can researchers troubleshoot issues with cytochrome b6f complex assembly when using recombinant components?

Assembly of multi-subunit membrane complexes presents unique challenges.

Methodology:

  • Co-expression strategies:

    • Polycistronic expression of multiple subunits

    • Sequential induction protocols

    • Inclusion of assembly factors and chaperones

  • Assembly condition optimization:

    • Lipid composition screening

    • Metal ion and cofactor supplementation

    • Redox environment control

  • Analytical approaches to identify bottlenecks:

    • Pulse-chase experiments to track assembly intermediates

    • Subunit ratio optimization

    • Native PAGE analysis of assembly states

Lessons from PetN studies show that loss of even small subunits can significantly impair complex stability , suggesting careful attention to stoichiometry and assembly order.

What spectroscopic methods are most informative for studying recombinant Chara vulgaris cytochrome b6f complex function?

Spectroscopic techniques provide critical insights into electron transport function.

Methodology:

  • Absorption spectroscopy:

    • Reduced minus oxidized difference spectra

    • Kinetic measurements of cytochrome reduction/oxidation

    • Signature wavelengths: cytochrome b6 (563 nm), cytochrome f (554 nm)

  • EPR spectroscopy:

    • Detection of Rieske iron-sulfur cluster

    • Identification of semiquinone intermediates

    • Assessment of heme environments

  • Resonance Raman spectroscopy:

    • Analysis of heme coordination and environment

    • Detection of structural changes during electron transfer

    • Identification of protein-cofactor interactions

  • Time-resolved fluorescence:

    • Measurement of state transitions similar to those analyzed in PetN studies

    • Excitation energy distribution between photosystems

    • Correlation of complex function with energy transfer efficiency

Analytical considerations:

  • Comparison of spectra between recombinant and native complexes

  • Effects of detergent environment on spectral properties

  • Calibration against known standards and model systems

How can researchers quantitatively assess electron transport rates through recombinant cytochrome b6f complexes?

Quantitative functional assessment requires specialized electrochemical and spectroscopic approaches.

Methodology:

  • Oxygen polarography:

    • Clark-type electrode measurements

    • Artificial electron donor/acceptor pairs

    • Inhibitor titration studies

  • Spectroelectrochemistry:

    • Potential-controlled UV-vis spectroscopy

    • Determination of midpoint potentials

    • Electron transfer kinetics assessment

  • Flash photolysis:

    • Light-activated electron transfer measurement

    • Transient absorption spectroscopy

    • Component-specific electron transfer rates

  • Stopped-flow spectroscopy:

    • Rapid mixing kinetic measurements

    • Pre-steady state reaction analysis

    • Rate constant determination

Studies of cyanobacterial mutants have shown that cytochrome b6f inhibitors like 2,5-dibromo-3-methyl-6-isopropylbenzoquinone can provide valuable insights into complex function . Similar approaches can be applied to recombinant C. vulgaris complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.