Recombinant Chara vulgaris Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
petB
Target Protein Sequence
MGKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFIVQVATGFAMTFYYRP TVTEAFASIQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWIT GVVLAVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPIVGSSLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Chara vulgaris Cytochrome b6 (petB) and what is its role in photosynthesis?

Cytochrome b6 is a critical component of the cytochrome b6f complex, which functions in the electron transport chain of photosynthesis. In Chara vulgaris, this protein facilitates electron transfer between photosystem II and photosystem I. The protein contains multiple heme groups that participate in redox reactions, making it essential for photosynthetic energy conversion and cyclic electron flow. Understanding its structure-function relationship provides insights into the fundamental mechanisms of photosynthesis in green algae.

What are the optimal conditions for culturing Chara vulgaris for gene expression studies?

Based on the research methodologies described in the literature , Chara vulgaris can be cultured under the following conditions:

  • Temperature range: 20-30°C (with evidence that temperature affects RNA processing)

  • Light conditions: Illumination at approximately 500 μE m−2 s−1 using a combination of LED and plant growth lights

  • Culture environment: 20-liter aquarium with pond mud and water, maintained in greenhouse with natural light

  • Regular replenishment with pond water or distilled water

  • pH range: 6-8, with monitoring for changes in alkalinity

Regular monitoring of growth conditions is essential as environmental factors can significantly impact gene expression patterns.

What extraction methods provide high-quality RNA from Chara vulgaris for petB expression studies?

For high-quality RNA extraction from Chara vulgaris, the following protocol has proven effective :

  • Harvest fresh thalli and wash thoroughly with distilled water to remove contaminants

  • Blot excess water using paper towels

  • Immediately flash-freeze the tissue in liquid nitrogen

  • Grind the frozen tissue into a fine powder using a mortar and pestle

  • Extract RNA using commercial kits such as Qiagen's RNeasy kit

  • Include the optional DNase treatment to ensure DNA-free RNA preparations

  • Determine RNA yield and quality using spectrophotometry (e.g., Nanodrop)

This method yields high-quality RNA suitable for downstream applications including RT-PCR, RNA-Seq, and expression studies focused on the petB gene.

What expression systems are most effective for recombinant Chara vulgaris Cytochrome b6 production?

For successful expression of recombinant Chara vulgaris Cytochrome b6, several expression systems should be considered:

  • Bacterial systems:

    • E. coli BL21(DE3) strain is widely used for recombinant protein expression

    • Transformation efficiency can be optimized using calcium chloride heat-shock methods

    • Expression vectors such as pET32a provide fusion tags that enhance solubility

  • Algal expression systems:

    • Chlamydomonas reinhardtii offers a more native-like environment for algal proteins

    • Provides appropriate post-translational modifications that might be essential for function

  • Cell-free expression systems:

    • May be advantageous for membrane proteins like Cytochrome b6

    • Allows controlled incorporation of cofactors such as heme

Each system has advantages and limitations that should be evaluated based on research goals and downstream applications.

What are the key considerations for designing primers for PCR amplification of the petB gene?

Designing effective primers for petB amplification requires careful consideration of several factors:

  • Sequence specificity:

    • Design primers based on conserved regions of the petB gene

    • Avoid regions with high sequence similarity to other genes

    • Check for possible internal priming sites within the petB gene

  • Primer properties:

    • Maintain GC content between 40-60%

    • Avoid secondary structures and primer-dimer formation

    • Ensure similar melting temperatures for forward and reverse primers

  • Application-specific considerations:

    • For cloning, include appropriate restriction enzyme sites

    • For RNA editing studies, position primers to capture known or predicted edit sites

    • For qPCR, design amplicons of 80-150 bp for optimal efficiency

  • Controls and validation:

    • Include positive control primers targeting conserved genes

    • Validate specificity through Sanger sequencing of amplicons

    • Test primers using both genomic DNA and cDNA templates

Well-designed primers are essential for successful amplification and downstream applications.

How can induction conditions be optimized for maximum expression of recombinant Cytochrome b6?

Optimization of induction conditions is critical for efficient expression of recombinant Cytochrome b6:

ParameterRange to TestConsiderations
Growth phaseOD600 0.4-0.8Optimal density typically 0.5-0.6 for E. coli systems
IPTG concentration0.1-1.0 mM1 mM final concentration is standard but lower concentrations may reduce metabolic burden
Temperature15-37°CLower temperatures (15-25°C) often enhance soluble protein expression
Induction duration3-24 hoursPerform time course analysis (3, 6 hours) to determine optimal harvest point
Media compositionLB, TB, minimal mediaRich media for maximum yield vs. defined media for consistency

For membrane proteins like Cytochrome b6, lower induction temperatures and extended expression times often yield better results in terms of properly folded, functional protein.

How can RNA editing events in the petB gene be detected and characterized?

RNA editing detection in the petB gene can be accomplished using several complementary approaches:

  • Deep sequencing comparison:

    • Sequence both genomic DNA and cDNA derived from RNA

    • Align sequences to identify consistent differences between DNA and RNA

    • Establish minimum coverage thresholds (e.g., >30×) for reliable edit site calling

  • Targeted validation methods:

    • RNase H-dependent PCR (rhPCR) can discriminate between edited and non-edited transcripts

    • Design primers with ribonucleotides at potential edit sites

    • Differential amplification occurs based on 3' blocking nucleotide removal

  • High-resolution melting analysis (HRM):

    • Detect subtle differences in melting temperatures between edited and non-edited amplicons

    • Requires careful control of template concentration and quality

    • Statistical analysis to determine significance of observed differences

  • Sanger sequencing:

    • Direct sequencing of RT-PCR products to confirm edit sites

    • Multiple biological replicates to ensure consistency

    • Controls to rule out DNA contamination

These methods should be used in combination to provide robust evidence for RNA editing events.

What environmental factors influence RNA editing in Chara vulgaris, and how can these be experimentally controlled?

Based on research findings, several environmental factors can influence RNA editing in Chara vulgaris:

  • Temperature effects:

    • RNA editing patterns may vary between samples collected at different temperatures (20°C, 25°C, 30°C)

    • Controlled growth chambers should be used for precise temperature regulation

    • Time course experiments can reveal adaptation versus acute responses

  • pH influence:

    • Testing pH ranges (6-8) can identify potential pH-dependent editing patterns

    • Buffer systems should maintain stable pH throughout experiments

    • Monitor for pH drift during long-term culturing

  • Light conditions:

    • Intensity and spectral quality may affect editing efficiency

    • Controlled light sources with defined parameters are essential

    • Photoperiod length should be standardized

  • Experimental design considerations:

    • Include multiple biological replicates at each condition

    • Implement factorial designs to test interaction effects

    • Use appropriate statistical methods (e.g., two-way ANOVA) to analyze results

Careful control and documentation of these variables is essential for reproducible RNA editing studies.

How do RNA editing events in petB potentially affect Cytochrome b6 structure and function?

RNA editing can introduce significant changes to protein structure and function through the following mechanisms:

  • Amino acid substitutions:

    • Changes in physicochemical properties (charge, size, hydrophobicity)

    • Alterations in local secondary structure elements

    • Modifications to functional domains or active sites

  • Structural predictions:

    • Secondary structure can be assessed using tools like NetSurfP-2.0

    • Predicted models can be visualized with PyMol to evaluate structural changes

    • Global quality scores provide confidence metrics for structural predictions

  • Functional implications:

    • Alterations in redox potential of the heme environment

    • Changes in protein-protein interaction surfaces

    • Modifications to electron transfer efficiency

  • Experimental validation approaches:

    • Site-directed mutagenesis to recreate edited states

    • Spectroscopic analysis of variants (absorption, CD, fluorescence)

    • Functional assays measuring electron transfer rates

Understanding these structure-function relationships is crucial for interpreting the biological significance of RNA editing events.

What purification strategy yields functional recombinant Cytochrome b6 with intact heme groups?

Purification of functional Cytochrome b6 with intact heme groups requires a carefully designed protocol:

  • Cell lysis and initial extraction:

    • Gentle lysis methods to preserve protein structure

    • Buffer optimization with appropriate detergents for membrane protein solubilization

    • Inclusion of protease inhibitors to prevent degradation

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Consider using cobalt resins for higher specificity than nickel

    • Implement gradient elution for improved separation

  • Heme retention strategies:

    • Include reducing agents (e.g., β-mercaptoethanol) in all buffers

    • Avoid harsh detergents that might disrupt heme binding

    • Consider supplementation with exogenous heme during purification

  • Quality assessment:

    • SDS-PAGE analysis for purity determination

    • Western blotting for identity confirmation

    • Spectrophotometric analysis to verify heme incorporation

A successful purification will yield protein with the characteristic absorption spectrum of cytochrome b6, indicating proper heme incorporation and protein folding.

How can structural integrity and proper folding of recombinant Cytochrome b6 be verified?

Verification of structural integrity requires multiple complementary approaches:

  • Spectroscopic methods:

    • UV-visible spectroscopy to confirm characteristic heme absorption peaks

    • Circular dichroism (CD) to assess secondary structure elements

    • Fluorescence spectroscopy for tertiary structure evaluation

  • Computational analysis:

    • Secondary structure prediction using methods like those described for C-type lectin

    • Evaluation of alpha helices, beta strands, and coil regions

    • Assessment of disordered regions which may affect function

  • Functional integrity tests:

    • Electron transfer activity measurements

    • Binding assays with known interaction partners

    • Redox potential determination

  • Thermal stability assessment:

    • Thermal shift assays to determine melting temperature

    • Comparison with native protein when available

    • Evaluation of buffer conditions that enhance stability

These methods collectively provide a comprehensive assessment of protein quality prior to functional studies.

How can recombinant Chara vulgaris Cytochrome b6 be used to study evolutionary adaptations in photosynthetic systems?

Recombinant Cytochrome b6 provides a powerful tool for evolutionary studies:

  • Comparative analysis framework:

    • Expression of Cytochrome b6 from multiple species (algae, higher plants, cyanobacteria)

    • Direct comparison of biochemical properties under standardized conditions

    • Correlation of functional differences with habitat and evolutionary history

  • Structure-function relationships across lineages:

    • Identification of conserved versus variable regions

    • Mapping of functionally critical residues

    • Integration with phylogenetic analyses

  • Adaptation signatures:

    • Identification of sites under positive selection

    • Correlation of sequence variations with environmental parameters

    • Functional testing of putative adaptive mutations

  • Experimental approaches:

    • Site-directed mutagenesis to recreate ancestral states

    • Chimeric protein construction to isolate functional domains

    • Heterologous expression in model organisms for in vivo assessment

These approaches connect molecular evolution with functional adaptations in photosynthetic systems across diverse lineages.

What methodological approaches can integrate transcriptome data with protein function studies for Cytochrome b6?

Integration of transcriptomic and functional data requires a multi-layered approach:

  • Transcriptome analysis foundations:

    • Deep sequencing of RNA as described for Chara vulgaris

    • Alignment to reference genome and variant calling

    • Identification of transcript isoforms and RNA editing events

  • Expression-function correlation:

    • Quantitative measurement of transcript levels under various conditions

    • Parallel assessment of protein abundance using western blotting

    • Activity assays to measure functional protein levels

  • Integration methodology:

    • Statistical correlation between transcript changes and functional outcomes

    • Time-course analysis to establish cause-effect relationships

    • Mathematical modeling of gene-protein-function relationships

  • Experimental validation:

    • Targeted manipulation of transcript levels (overexpression, knockdown)

    • Introduction of specific transcript variants

    • Assessment of resulting phenotypic and functional changes

This integrated approach provides a comprehensive understanding of how transcriptional regulation influences Cytochrome b6 function in photosynthetic processes.

How can contradictory results between different analytical methods be reconciled when studying Cytochrome b6?

Addressing contradictory results requires a systematic investigation approach:

  • Method validation and standardization:

    • Direct side-by-side comparison of methods under identical conditions

    • Inclusion of well-characterized positive and negative controls

    • Calibration of instruments and standardization of protocols

  • Sample-specific considerations:

    • Assessment of sample quality and potential degradation

    • Evaluation of buffer compatibility across methods

    • Consideration of protein heterogeneity (isoforms, modifications)

  • Data integration strategies:

    • Meta-analysis approaches when multiple datasets exist

    • Weighted analysis based on method reliability and sensitivity

    • Development of models that can explain apparent contradictions

  • Critical evaluation examples:

    • When RNA editing appears inconsistent between methods (as seen in the HRM vs. rhPCR results for Chara)

    • Verification with additional orthogonal methods

    • Consideration of biological variability versus technical artifacts

Careful documentation and transparent reporting of all findings, including contradictory results, advances scientific understanding and methodology development.

What strategies can address poor expression of recombinant Cytochrome b6 in heterologous systems?

Poor expression can be systematically addressed through the following approaches:

  • Expression construct optimization:

    • Codon optimization for the host organism

    • Alternative fusion tags to enhance solubility

    • Evaluation of expression vector features (promoter strength, copy number)

  • Host strain selection:

    • Testing specialized strains for membrane proteins

    • Strains with enhanced capacity for cofactor incorporation

    • Consideration of E. coli BL21(DE3) as a starting point

  • Growth and induction optimization:

    • Lower temperature cultivation (16-20°C)

    • Reduced inducer concentration

    • Extended expression time at lower temperatures

    • Monitoring optical density to determine optimal induction point (OD600 0.5-0.6)

  • Heme availability:

    • Supplementation with δ-aminolevulinic acid (ALA) to enhance heme biosynthesis

    • Iron supplementation in growth medium

    • Co-expression of heme biosynthesis enzymes

These strategies should be tested systematically with appropriate controls to identify optimal conditions for each specific construct.

How can RNA extraction and quality issues be overcome when working with Chara vulgaris?

RNA extraction from Chara vulgaris presents specific challenges that can be addressed through:

  • Tissue preparation optimization:

    • Thorough washing of thalli to remove contaminants

    • Immediate flash freezing to prevent RNA degradation

    • Efficient grinding to fine powder for complete cell disruption

    • Processing small batches to maintain low temperature

  • Extraction method refinements:

    • Comparison of different commercial kits (RNeasy, TRIzol, etc.)

    • Modified CTAB-based methods for recalcitrant samples

    • Addition of RNA stabilization reagents during extraction

    • Inclusion of additional purification steps for high-purity RNA

  • Quality control implementation:

    • RNA integrity assessment using Bioanalyzer or gel electrophoresis

    • A260/A280 and A260/A230 ratios for purity evaluation

    • DNase treatment verification through PCR without reverse transcription

    • Multiple extraction attempts from the same biological samples

  • Downstream application optimization:

    • Adjustment of input RNA amounts based on quality

    • Modified cDNA synthesis protocols for challenging templates

    • Use of random hexamers in addition to oligo(dT) for complete representation

These approaches ensure high-quality RNA suitable for sensitive applications such as RNA editing detection and transcriptome analysis.

What bioinformatic pipelines are recommended for analyzing RNA-Seq data to study petB expression and editing?

Analysis of RNA-Seq data for petB studies requires a comprehensive bioinformatic pipeline:

  • Quality control and preprocessing:

    • FastQC for read quality assessment

    • Trimmomatic or similar tools for adapter removal and quality trimming

    • Filtering of low-complexity sequences

  • Alignment and assembly:

    • Reference-guided alignment using tools like STAR or Bowtie2

    • De novo assembly options for novel transcript discovery

    • Specific parameter optimization for algal genomes

  • Edit site identification:

    • Variant calling to identify DNA-RNA differences

    • Filtering criteria to distinguish true edits from sequencing errors

    • Coverage requirements (typically >30×) for confident edit site calling

    • Calculation of editing efficiency at each site

  • Expression analysis:

    • Normalization methods appropriate for RNA-Seq data

    • Differential expression testing between conditions

    • Multiple testing correction for genome-wide analyses

  • Visualization and interpretation:

    • Genome browser visualization for manual inspection

    • Custom R scripts for editing efficiency visualization

    • Integration with protein structure data for functional interpretation

This pipeline should be implemented following best practices in bioinformatics to ensure reliable results and reproducibility.

How can the functional impact of RNA editing on Cytochrome b6 be experimentally validated?

Experimental validation of RNA editing effects requires multi-level approaches:

  • Recombinant protein studies:

    • Site-directed mutagenesis to recreate edited states

    • Expression and purification of edited and non-edited variants

    • Comparative biochemical characterization

  • Spectroscopic analysis:

    • Absorption spectroscopy to detect heme environment changes

    • Circular dichroism for secondary structure comparison

    • Fluorescence spectroscopy for tertiary structure assessment

  • Functional assays:

    • Electron transfer kinetics measurements

    • Redox potential determination

    • Protein-protein interaction studies with partner proteins

    • Thermal stability comparisons

  • In vivo validation approaches:

    • Complementation studies in model organisms

    • Assessment of photosynthetic parameters

    • Growth and fitness measurements under various conditions

These comprehensive approaches connect molecular changes with physiological consequences, providing insight into the biological significance of RNA editing events.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.