Recombinant Chara vulgaris NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
ndhC
Target Protein Sequence
MGTLQEYDYLWFFLVIASIVPILAFTISEILAPIRSGPEKLTSYESGIEPKGQAWIQFHI RYYMFALVFVVFDVETVFLYPWAISFHSLGISAFIEALLFILILMVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This process couples redox reactions with proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of NAD(P)H-quinone oxidoreductase in photosynthetic organisms?

NAD(P)H-quinone oxidoreductases in photosynthetic organisms catalyze the two-electron reduction of quinones to hydroquinones. In chloroplasts, ndhC functions as part of the NAD(P)H dehydrogenase complex (NDH) involved in cyclic electron transport around photosystem I. This enzyme family generally protects cells from the deleterious effects of quinones and other electrophiles by preventing one-electron reduction reactions that would generate harmful radical species . In photosynthetic organisms like Chara vulgaris, the chloroplastic ndhC specifically contributes to energy balance during photosynthesis, particularly under stress conditions.

How does the chloroplastic ndhC differ from other NAD(P)H-quinone oxidoreductase enzymes?

While cytosolic NAD(P)H-quinone oxidoreductases like NQO1 are largely involved in detoxification processes, the chloroplastic ndhC has evolved specifically for photosynthetic function. The chloroplastic enzyme participates in the NDH complex that mediates electron flow from stromal NAD(P)H back to plastoquinone, supporting cyclic electron transport. Unlike the cytosolic counterparts that function as homodimers with one FAD per monomer , chloroplastic ndhC operates as part of a multi-subunit membrane protein complex integrated with the thylakoid membrane system.

What is known about the expression patterns of ndhC in Chara vulgaris?

The expression of ndhC in Chara vulgaris is typically induced under specific stress conditions, particularly those that affect photosynthetic efficiency. While direct expression data for Chara vulgaris ndhC is limited in the available literature, research on related algal species suggests upregulation under high light intensity, drought stress, and temperature fluctuations. The expression patterns differ from those of cytosolic quinone reductases like QR1, which are inducible by a wide variety of Michael reaction acceptors and other electrophiles .

How do structural differences between chloroplastic ndhC and cytosolic NQO1 affect their catalytic mechanisms?

The cytosolic NAD(P)H:quinone oxidoreductase (NQO1) utilizes a ping-pong mechanism where NAD(P)H first reduces the FAD cofactor, then NAD(P)+ leaves the catalytic site allowing the substrate quinone to bind and receive electrons . In contrast, chloroplastic ndhC likely functions through a different mechanism involving direct electron transfer from NAD(P)H to the plastoquinone pool.

The structural basis for these different mechanisms can be partially inferred from studies of QR1 structures, which revealed that Tyrosine-128 and the loop spanning residues 232-236 close the binding site after substrate or cofactor binding . The chloroplastic ndhC likely has different key residues controlling access to its active site, reflecting its specialized role in photosynthetic electron transport rather than general quinone detoxification.

What are the implications of genetic variants of ndhC in Chara vulgaris for photosynthetic efficiency?

While specific genetic variants of ndhC in Chara vulgaris have not been extensively characterized, research on NAD(P)H:quinone oxidoreductase variants in other organisms suggests potential functional impacts. In humans, three alleles of NQO1 have been identified with varying activities: the functional NQO11 (Arg139/Pro187), the nonfunctional NQO12 (Arg139/Ser187), and NQO1*3 (Trp139/Pro187) with diminished activity .

By analogy, genetic variations in Chara vulgaris ndhC might affect:

Research examining such variations would provide valuable insights into the evolution of photosynthetic electron transport mechanisms.

How does the redox sensitivity of ndhC compare to that of other chloroplastic and cytosolic quinone oxidoreductases?

The chloroplastic ndhC likely exhibits distinct redox sensitivity compared to cytosolic counterparts like NQO1. The latter functions primarily in quinone detoxification, while ndhC must respond to the fluctuating redox environment of the chloroplast during photosynthesis. Studies on human and mouse QR1 have shown structural changes accompanying substrate or cofactor binding and release, suggesting sophisticated redox-responsive mechanisms .

In chloroplasts, the redox environment fluctuates rapidly in response to light intensity, and ndhC must operate efficiently under these changing conditions. The thioredoxin system in chloroplasts likely modulates ndhC activity through redox-based regulation, a mechanism distinct from the regulation of cytosolic quinone oxidoreductases.

What are the optimal conditions for expressing recombinant Chara vulgaris ndhC in heterologous systems?

For successful expression of recombinant Chara vulgaris ndhC, researchers should consider the following protocol:

  • Expression System Selection: E. coli systems (BL21(DE3) or Rosetta strains) are recommended for initial attempts, though eukaryotic systems like Chlamydomonas may better preserve post-translational modifications.

  • Vector Design: Include a strong inducible promoter (T7 or trc), codon-optimization for the host organism, and fusion tags (N-terminal His6 or MBP) to aid purification.

  • Expression Conditions:

    • Temperature: 16-20°C for 16-24 hours (to minimize inclusion body formation)

    • IPTG concentration: 0.1-0.5 mM

    • Media: TB or modified M9 medium supplemented with riboflavin (10 μg/mL)

    • Consider co-expression with molecular chaperones (GroEL/GroES)

  • Solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (0.5-1%) for membrane extraction

Similar approaches have been successful for expressing other quinone oxidoreductases, as demonstrated in structural studies of human and mouse QR1 .

What purification strategies are most effective for recombinant ndhC protein?

A multi-step purification strategy is recommended for recombinant ndhC:

Purification StepConditionsExpected Results
Affinity ChromatographyNi-NTA or amylose resin (for His or MBP tags); 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol>80% purity, removal of bulk contaminants
Ion ExchangeQ-Sepharose, pH 7.5-8.0, 50-500 mM NaCl gradientRemoval of nucleic acid contamination
Size ExclusionSuperdex 200, 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol>95% purity, confirmation of oligomeric state

Throughout purification, maintain reducing conditions (2-5 mM DTT or 0.5-1 mM TCEP) and include FAD (10 μM) to stabilize the protein. For structural studies, a final purity of >98% is achievable through this approach, comparable to the methods used for crystallizing human QR1 at 1.7-Å resolution .

How can researchers assess the enzymatic activity of purified ndhC protein?

For accurate assessment of purified ndhC enzymatic activity, the following spectrophotometric assay protocol is recommended:

  • Reaction Buffer: 50 mM Tris-HCl (pH 7.4), 0.1% Triton X-100, 0.2 mg/mL BSA, 500 μM NADH or NADPH

  • Substrates: Use multiple quinone substrates for comparative analysis:

    • Duroquinone (2,3,5,6-tetramethyl-p-benzoquinone): 50-200 μM

    • Plastoquinone or analogues: 50-200 μM

    • Menadione (vitamin K3): 50-100 μM

  • Measurement Parameters:

    • Monitor NADH/NADPH oxidation at 340 nm

    • Follow quinone reduction at appropriate wavelengths

    • Maintain temperature at 25°C

    • Record readings every 10 seconds for 5 minutes

  • Analysis: Calculate specific activity (μmol/min/mg protein) using extinction coefficients:

    • NADH/NADPH: ε₃₄₀ = 6,220 M⁻¹cm⁻¹

    • For quinone reduction: use substrate-specific extinction coefficients

This approach enables comparison with cytosolic oxidoreductases, for which menadione reduction rates have been shown to differ by a factor of 2 between human/mouse and rat enzymes .

What techniques are most effective for resolving the structure of ndhC and its interaction with binding partners?

For structural elucidation of ndhC and its interactions, a multi-technique approach is recommended:

These approaches would enable identification of key structural features analogous to those observed in QR1, such as the role of specific residues in binding site closure and substrate specificity .

How can researchers investigate the specific role of ndhC in the NDH complex of Chara vulgaris?

To elucidate the specific role of ndhC within the NDH complex, the following experimental strategy is recommended:

  • Site-Directed Mutagenesis: Target conserved residues predicted to be involved in:

    • NAD(P)H binding

    • Quinone binding

    • Subunit interactions
      Analyze the effects on complex assembly and activity.

  • Knockout/Knockdown Studies: Using CRISPR-Cas9 or RNAi approaches in Chara vulgaris to reduce ndhC expression, followed by physiological assessments:

    • Photosynthetic efficiency (PAM fluorometry)

    • Cyclic electron flow rates

    • Stress response

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with antibodies against ndhC

    • Crosslinking mass spectrometry to identify interaction interfaces

    • Blue native PAGE to assess complex integrity

  • In vivo Functional Complementation:

    • Express wildtype or mutant ndhC in ndhC-deficient backgrounds

    • Assess restoration of NDH complex function

This approach would provide insights into how ndhC contributes to the larger complex, similar to investigations that revealed the role of specific residues like Tyr-104 in determining substrate specificity differences between rat and human/mouse QR1 .

What bioactive compounds from Chara vulgaris might interact with or modulate ndhC activity?

HPLC analysis of Chara vulgaris has revealed several bioactive compounds that may interact with ndhC:

Compound ClassRepresentative CompoundsPotential Interaction
Phenolic Compoundsp-Coumaric acid (21.84%)May act as alternative electron acceptors or modulators
TerpenesUrsolic acid (17.82%)Potential allosteric regulators of enzyme activity
FlavonoidsVarious (detected at lower levels)May compete with quinone substrates

These compounds have been identified in Chara vulgaris aqueous extract through HPLC separation . The high levels of p-coumaric acid particularly suggest potential interactions with oxidoreductases. Given that NAD(P)H:quinone oxidoreductases like QR1 show inducibility by Michael reaction acceptors and electrophiles , these naturally occurring compounds might serve as modulators of ndhC activity in vivo.

Experimental approaches to investigate these interactions would include:

  • Enzyme inhibition/activation assays with purified compounds

  • Thermal shift assays to detect binding

  • Spectroscopic methods to monitor changes in redox state

How do environmental factors affect the expression and activity of ndhC in Chara vulgaris?

Environmental factors significantly impact ndhC expression and activity in Chara vulgaris. A comprehensive investigation would include:

  • Light Conditions:

    • High light intensity typically increases NDH complex activity for photoprotection

    • Blue light may specifically upregulate ndhC expression

    • Measure protein levels via western blot and mRNA via qRT-PCR under varying light regimes

  • Temperature Stress:

    • Heat or cold stress alter photosynthetic electron transport requirements

    • NDH complex activity often increases under temperature extremes

    • Analyze enzyme kinetics at different temperatures (15-40°C)

  • Nutrient Availability:

    • Carbon limitation enhances cyclic electron flow

    • Monitor ndhC expression under varying CO₂ concentrations

    • Assess activity changes during nitrogen or phosphorus limitation

  • Oxidative Stress:

    • H₂O₂ or methyl viologen treatment creates oxidative stress

    • Measure changes in ndhC expression and activity

    • Evaluate how ndhC contributes to stress tolerance

This research would complement studies on cytosolic QR1, which is inducible by various electrophiles , by determining whether chloroplastic ndhC responds to similar signals or has evolved distinct regulatory mechanisms specific to photosynthetic function.

What are the most promising applications of recombinant Chara vulgaris ndhC in biotechnology?

Recombinant Chara vulgaris ndhC holds significant potential for several biotechnology applications:

  • Improved Photosynthetic Efficiency: Engineering crop plants with optimized ndhC could enhance cyclic electron flow and boost productivity under stress conditions.

  • Bioremediation: The quinone-reducing activity makes ndhC potentially useful for detoxification of quinone pollutants, similar to the protective role of QR1 against quinone toxicity .

  • Biosensors: ndhC-based electrochemical biosensors could detect quinones and related compounds in environmental monitoring.

  • Synthetic Biology: Integration into artificial photosynthetic systems for sustainable energy production.

Future research should focus on structure-function relationships that could enhance these applications, particularly by understanding how the protein's activity could be optimized for specific biotechnological purposes.

What challenges remain in understanding the evolution of ndhC across different photosynthetic organisms?

Several significant challenges persist in understanding ndhC evolution:

  • Sequence Diversity: High sequence divergence makes accurate alignments difficult, particularly between distant taxonomic groups.

  • Functional Divergence: The function of ndhC may vary across lineages, with some organisms using it primarily for photoprotection and others for carbon concentration.

  • Horizontal Gene Transfer: Evidence suggests possible horizontal transfer of ndh genes between cyanobacteria and early eukaryotic algae.

  • Loss in Some Lineages: Some photosynthetic organisms have lost ndh genes, suggesting alternative mechanisms can compensate for their function.

Comparative genomic and biochemical studies across diverse algae would help address these challenges, similar to how polymorphism studies of human NQO1 have revealed ethnic variations in allele frequencies .

How might structural information about ndhC inform the development of photoprotective compounds?

Structural insights into ndhC could guide the development of compounds that enhance photoprotection:

  • Binding Site Targeting: Understanding the quinone binding pocket could inform the design of compounds that modulate cyclic electron flow, similar to how structural studies of human QR1-duroquinone interactions revealed hydride transfer mechanisms .

  • Allosteric Modulators: Identification of allosteric sites could lead to compounds that enhance ndhC activity under stress conditions.

  • Stability Enhancers: Compounds that improve the stability of the NDH complex in extreme conditions could increase stress tolerance.

  • Cross-Species Design: Comparative analysis of ndhC structure across species could reveal conserved features for targeting with broad-spectrum photoprotective compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.