Recombinant Chara vulgaris NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Chloroplast Electron Transport

The ndhE subunit is part of the NDH complex, which shuttles electrons from NAD(P)H to plastoquinone in chloroplasts . This activity is coupled to proton translocation, contributing to the proton gradient essential for ATP synthesis .

Redox Regulation and Detoxification

While primarily associated with photosynthesis, NDH-like complexes in other organisms (e.g., humans) also participate in detoxification by reducing reactive quinones . Though direct detox roles for Chara vulgaris ndhE remain unconfirmed, its structural homology to NQO1 (NAD(P)H quinone oxidoreductase 1) suggests potential overlapping functions .

Recombinant Expression

The protein is produced via bacterial expression systems, with the following workflow:

  1. Cloning: The ndhE gene is inserted into a plasmid vector for expression in E. coli.

  2. Induction: Expression is induced under controlled conditions to maximize yield .

  3. Purification: His-tag affinity chromatography isolates the protein, followed by buffer exchange for storage .

Quality Control

ParameterSpecificationSources
Storage BufferTris-based buffer with 50% glycerol
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles
ApplicationsELISA, biochemical assays, structural studies

Photosynthetic Studies

  • Electron Transport Analysis: Used to study NDH-mediated electron flow in chloroplasts, particularly in non-photosynthetic pathways .

  • Proton Gradient Formation: Investigates coupling mechanisms between redox reactions and ATP synthesis .

Comparative Genomics

  • Gene Evolution: The ndhE gene is conserved in chloroplast genomes but lost in some angiosperms and gymnosperms .

  • Functional Divergence: Structural comparisons with mitochondrial NDH subunits (e.g., nad4L) reveal lineage-specific adaptations .

Table 1: Key Functional Domains and Interactions

Domain/InteractionRoleEvidence
FMN-binding siteElectron transfer from NAD(P)H to quinonesStructural homology
Iron-sulfur clustersMediates electron shuttling between subunitsFunctional assays
Proton channelTransmembrane proton translocationBiochemical studies

Table 2: Comparative Evolution of ndhE in Chloroplast Genomes

OrganismGene RetentionChloroplast PositionReferences
Chara vulgarisIntactChloroplast genome
AngiospermsLost in many lineages-
GymnospermsLost in most species-

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. Specify your desired tag type for prioritized development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
ndhE
Target Protein Sequence
MILQHILILSSFLFCLGIFGLITSQNMVKILICLELIFNAVNLNLVIFCKFFDSSAIIGN LFGLFIIAIAAAEAAIALAILLAMYRNRRSIRIDRFNILK
Uniprot No.

Target Background

Function

NDH shuttles electrons from NAD(P)H:plastoquinone to quinones in the photosynthetic and potentially chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this species, the primary electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, conserving redox energy within a proton gradient.

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining protein stability and activity?

Recombinant Chara vulgaris NAD(P)H-quinone oxidoreductase subunit 4L is supplied as a lyophilized powder and requires specific storage protocols to maintain stability. The recommended storage conditions include:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple uses to prevent protein degradation

  • Avoid repeated freeze-thaw cycles as they compromise protein integrity

  • For reconstituted protein, store working aliquots at 4°C for up to one week

These conditions minimize protein denaturation and preserve enzymatic activity. The presence of 6% trehalose in the storage buffer (Tris/PBS-based, pH 8.0) provides cryoprotection during freeze-thaw cycles and extends shelf life significantly . Research indicates that proteins stored under these conditions retain over 90% activity for at least 12 months.

What is the recommended reconstitution protocol for experimental use?

The optimal reconstitution protocol involves several critical steps:

  • Centrifuge the vial briefly before opening to collect all material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

This methodology preserves protein solubility and prevents aggregation. The addition of glycerol is particularly important as it prevents ice crystal formation during freezing, which could otherwise damage the protein's tertiary structure. Researchers should validate protein activity after reconstitution using appropriate enzymatic assays specific to NAD(P)H-quinone oxidoreductase activity.

How should experiments be designed to assess the functional activity of this protein?

When designing experiments to assess the functional activity of Recombinant Chara vulgaris NAD(P)H-quinone oxidoreductase subunit 4L, researchers should implement a structured approach:

  • Begin with an Experimental Design Assistant (EDA) diagram that clearly articulates:

    • Independent variables (e.g., substrate concentrations, pH, temperature)

    • Dependent variables (e.g., reaction rate, electron transfer efficiency)

    • Control conditions (positive, negative, and vehicle controls)

    • Randomization and blinding strategies to minimize bias

  • Include standard activity assays measuring:

    • NADH/NADPH oxidation (absorbance at 340 nm)

    • Quinone reduction kinetics

    • Oxygen consumption rates in reconstituted systems

  • Validate experimental conditions with appropriate statistical power calculations to determine sample sizes that can detect physiologically relevant differences

The experimental design should explicitly account for nuisance variables that might affect protein activity, including variation in protein preparation, temperature fluctuations, and potential contamination with other electron transport proteins. Using the EDA approach helps researchers identify potential sources of experimental error before conducting actual experiments.

What controls are essential when working with this recombinant protein?

A robust experimental design with this protein requires multiple control conditions:

Positive Controls:

  • Commercially validated NAD(P)H-quinone oxidoreductase with known activity

  • Previously characterized batch of the same protein with established activity levels

Negative Controls:

  • Heat-inactivated protein (95°C for 5 minutes)

  • Reaction mixture without protein

  • Reaction mixture without substrate

Specificity Controls:

  • Known inhibitors of NAD(P)H-quinone oxidoreductase (e.g., rotenone, piericidin A)

  • Structurally similar proteins lacking key catalytic residues

How does the protein structure compare with homologous proteins from other photosynthetic organisms?

The Recombinant Chara vulgaris NAD(P)H-quinone oxidoreductase subunit 4L represents an interesting case for comparative structural biology:

OrganismSequence Identity (%)Key Structural DifferencesFunctional Implications
Chara vulgaris100 (reference)N/AAdapted to freshwater algal environment
Cyanobacteria45-55Shorter N-terminal domainAltered membrane topology
Higher plants60-75More conserved transmembrane regionsEnhanced stability in thylakoid membrane
Green algae70-85Similar hydrophobicity patternComparable electron transport function

This protein contains highly conserved regions involved in quinone binding and electron transfer, while displaying variability in membrane-anchoring domains. The 100-amino acid sequence positions this protein as relatively compact compared to homologs from higher plants . Phylogenetic analysis suggests that the Chara vulgaris variant represents an evolutionary intermediate between cyanobacterial and higher plant forms, offering insights into the adaptation of the photosynthetic apparatus during evolutionary transitions from aquatic to terrestrial environments.

What methodologies are most effective for studying protein-protein interactions involving this subunit?

Several complementary approaches can effectively characterize protein-protein interactions involving the NAD(P)H-quinone oxidoreductase subunit 4L:

  • Co-immunoprecipitation with His-tag Pull-down:

    • Leverage the His-tag present on the recombinant protein

    • Use nickel or cobalt affinity resins to capture protein complexes

    • Identify interacting partners through mass spectrometry

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers (e.g., DSS, BS3)

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Determine spatial relationships between interacting proteins

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescently labeled variants of the protein

    • Measure energy transfer between potential interaction partners

    • Quantify interaction dynamics in reconstituted membrane systems

When implementing these approaches, researchers should consider the membrane-associated nature of this protein, which necessitates the use of appropriate detergents or membrane mimetics to maintain native conformation. The analysis should also account for both stable and transient interactions, as electron transport complexes often involve dynamic associations that may be missed by techniques optimized for stable complexes.

What statistical approaches are most appropriate for analyzing experimental data?

Data analysis for experiments involving Recombinant Chara vulgaris NAD(P)H-quinone oxidoreductase should incorporate:

  • Enzyme Kinetics Analysis:

    • Michaelis-Menten kinetics for substrate affinity determination

    • Lineweaver-Burk or Eadie-Hofstee plots for kinetic parameter visualization

    • Global fitting approaches for complex reaction mechanisms

  • Statistical Testing Framework:

    • Power analysis to determine appropriate sample sizes

    • Analysis of variance (ANOVA) for multi-factor experiments

    • Appropriate post-hoc tests with correction for multiple comparisons

    • Non-parametric alternatives when normality assumptions are violated

  • Quality Control Metrics:

    • Coefficient of variation calculation to assess reproducibility

    • Outlier detection using Grubb's test or similar approaches

    • Sensitivity analysis to identify influential data points

The experimental design should explicitly define primary outcome measures before data collection begins, as emphasized by the Experimental Design Assistant framework . This approach prevents post-hoc selection of favorable outcomes and increases the reliability of research findings.

How can researchers troubleshoot experiments showing unexpectedly low enzymatic activity?

When encountering unexpectedly low enzymatic activity with this recombinant protein, researchers should systematically evaluate:

  • Protein Integrity Issues:

    • Verify protein concentration via Bradford or BCA assay

    • Assess purity by SDS-PAGE (should exceed 90%)

    • Check for aggregation using dynamic light scattering

    • Validate His-tag accessibility via Western blot

  • Buffer and Reaction Conditions:

    • Verify pH optimum (typically 7.0-8.0 for NAD(P)H oxidoreductases)

    • Evaluate buffer composition for inhibitory components

    • Test different reconstitution methods to improve membrane integration

    • Adjust ionic strength, which can significantly impact activity

  • Substrate and Cofactor Considerations:

    • Verify NAD(P)H quality and concentration

    • Ensure appropriate quinone substrate availability

    • Check for oxygen exclusion in anaerobic reactions

    • Determine if additional cofactors are required (e.g., FAD, FMN)

The storage history of the protein is particularly critical, as repeated freeze-thaw cycles significantly reduce activity . A systematic approach to troubleshooting should involve changing only one variable at a time while maintaining all others constant, ensuring that the effects of each modification can be clearly attributed to the parameter being investigated.

What are the most promising approaches for integrating this protein into artificial photosynthetic systems?

Integrating Recombinant Chara vulgaris NAD(P)H-quinone oxidoreductase subunit 4L into artificial photosynthetic systems requires sophisticated bioengineering approaches:

  • Proteoliposome Reconstitution:

    • Incorporate purified protein into liposomes with controlled lipid composition

    • Co-reconstitute with other electron transport components

    • Create oriented insertion using His-tag directional reconstitution

    • Measure vectorial electron transport across the membrane

  • Electrode Immobilization Strategies:

    • Direct adsorption onto carbon-based electrodes

    • Covalent attachment via engineered cysteine residues

    • Oriented immobilization using His-tag affinity to Ni-NTA modified surfaces

    • Encapsulation in conductive polymers to enhance electron transfer

  • Hybrid Systems Design:

    • Couple with semiconductor materials for light harvesting

    • Incorporate artificial quinones with optimized redox properties

    • Design biomimetic scaffolds that position redox centers at optimal distances

    • Implement protective matrices to enhance operational stability

These approaches enable researchers to harness the highly evolved electron transfer capabilities of this natural protein while overcoming limitations like oxygen sensitivity and limited stability outside the native environment. The compact size (100 amino acids) of this protein makes it particularly suitable for high-density surface immobilization strategies in bioelectronic applications.

How can advanced imaging techniques contribute to understanding this protein's role in chloroplast function?

Advanced imaging techniques provide powerful insights into the spatial organization and dynamic behavior of NAD(P)H-quinone oxidoreductase in chloroplasts:

  • Super-resolution Microscopy Approaches:

    • STORM/PALM imaging of fluorescently tagged protein

    • Dual-color imaging to visualize co-localization with other complex components

    • Single-particle tracking to monitor lateral mobility in thylakoid membranes

    • Quantitative analysis of clustering behavior under different physiological states

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Visualize protein distribution relative to thylakoid membrane architecture

    • Implement immunogold labeling for TEM studies using antibodies against the His-tag

    • Apply electron tomography for 3D contextual information

  • Functional Imaging Methods:

    • Fluorescence lifetime imaging to detect conformational changes

    • Förster resonance energy transfer to map protein-protein interactions

    • Ratiometric imaging of NAD(P)H/NAD(P)+ to visualize local redox states

    • Correlate protein distribution with chlorophyll fluorescence parameters

These techniques can reveal not only the static organization of protein complexes but also their dynamic rearrangements in response to changing light conditions, stress factors, or developmental stages. The integration of structural information with functional measurements provides a comprehensive understanding of how this protein contributes to photosynthetic electron transport efficiency in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.