Recombinant Chara vulgaris NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The ndhG subunit is part of the NDH complex, which:

  1. Catalyzes Electron Transfer: Transfers electrons from NAD(P)H to plastoquinone (PQ), contributing to cyclic electron flow around photosystem I .

  2. Regulates ATP Synthesis: Modulates the proton gradient required for ATP production via the chloroplast ATP synthase .

  3. Supports Stress Responses: May mitigate oxidative stress by scavenging reactive oxygen species (ROS) .

Production and Purification

The recombinant ndhG is produced via heterologous expression systems optimized for yield and stability.

Production ParameterDetails
Host SystemBaculovirus (insect cells) or E. coli
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (liquid) or -80°C (lyophilized); avoid repeated freeze-thaw cycles

Purification:

  • His-Tag Affinity Chromatography: Used for efficient isolation of the recombinant protein .

  • Reconstitution: Protein resuspended in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

Applications in Research

The recombinant ndhG enables advanced studies in photosynthesis and biotechnology:

ApplicationDescription
Enzyme KineticsCharacterization of NAD(P)H binding and electron transfer rates .
Structural AnalysisX-ray crystallography or cryo-EM to resolve subunit interactions within the NDH complex .
Biotechnological UsesEngineering photosynthetic efficiency in crops or bioenergy systems .

Comparative Analysis with Related Proteins

FeaturendhG (Chloroplastic) QR1 (Cytosolic)
FunctionPhotosynthetic electron transportDetoxification of quinones/ROS
SubstrateNAD(P)H → plastoquinoneNAD(P)H → quinones
Catalytic MechanismCyclic electron flowPing-pong mechanism
LocalizationChloroplast thylakoid membraneCytoplasm

Research Gaps and Future Directions

  • Structural Dynamics: Limited data on conformational changes during electron transfer.

  • Evolutionary Insights: Comparative studies with plant and algal NDH complexes to elucidate functional divergence.

  • Therapeutic Potential: Exploring ndhG’s role in ROS management for agricultural resilience.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order remarks, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
ndhG
Target Protein Sequence
MDFLNMSYQLIVAYLIQLGIYIGALAVIFFNNIVYAAISLALVLSLIALLYLFFDADFLA VTQILIYVGAINVLILFAIMLISLPKSSTFIFYFTKKSQISAFACISLFVLLVKIILQTP WSTQSSYILLNENNKLDQIGIYLLSNFLLPFELISLLLLIALIGAVSIARYQNTEETE
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The immediate electron acceptor for this enzyme in this species is thought to be plastoquinone. This process couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NAD(P)H-quinone oxidoreductase subunit 6 in Chara vulgaris?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) in Chara vulgaris is an essential component of the chloroplastic NAD(P)H dehydrogenase (NDH) complex involved in cyclic electron flow around Photosystem I. This protein plays a crucial role in optimizing photosynthetic efficiency under varying environmental conditions by facilitating alternative electron transport pathways. The NDH complex mediates electron transfer from NAD(P)H to plastoquinone, contributing to the generation of a proton gradient across the thylakoid membrane, which drives ATP synthesis. In Chara vulgaris, this function is particularly important for adapting to freshwater environments where light conditions may fluctuate .

How does the ndhG gene in Chara vulgaris compare structurally to those in land plants?

The structural organization of the ndhG gene in Chara vulgaris shares remarkable similarities with its counterparts in land plants, particularly bryophytes like Marchantia polymorpha. This similarity reflects the sister-group relationship between Charales and land plants suggested by mitochondrial genome studies . The gene in Chara maintains conserved domains essential for electron transport function while featuring algae-specific sequence variations. Comparative genomic analyses show that the genetic architecture surrounding ndhG in the chloroplast genome displays considerable synteny with land plants, with the gene typically forming part of conserved gene clusters that have remained intact throughout plant evolution. These structural similarities support the hypothesis that Charales represent a transitional group between aquatic algae and terrestrial plants .

What extraction methods are most effective for isolating chloroplastic proteins from Chara vulgaris?

For effective isolation of chloroplastic proteins including ndhG from Chara vulgaris, a modified acetone extraction protocol has shown superior results compared to other solvent-based methods. Based on extraction efficiency studies of various cellular components from this alga, acetone extraction yields the highest protein recovery with minimal contamination from calcium carbonate deposits that are abundant in Chara cell walls . The recommended method involves:

  • Fresh tissue homogenization in cold acetone (1:5 w/v ratio)

  • Centrifugation at 10,000×g for 15 minutes at 4°C

  • Collection of the supernatant followed by protein precipitation using trichloroacetic acid

  • Resuspension of the protein pellet in a suitable buffer system (typically pH 7.5-8.0)

This method yields approximately 3.2-3.8 mg/g fresh weight of total chloroplastic proteins with good retention of native structure, making it suitable for subsequent purification of functional ndhG protein .

What expression systems are optimal for producing recombinant Chara vulgaris ndhG?

The optimal expression system for recombinant Chara vulgaris ndhG depends on the research objectives. Based on comparative studies of chloroplastic protein expression, the following systems have demonstrated successful recombinant production with their respective advantages:

Expression SystemYield (mg/L culture)AdvantagesLimitations
E. coli BL21(DE3)0.8-1.2Simple, cost-effective, rapid growthPotential improper folding, lack of post-translational modifications
Chlamydomonas reinhardtii0.3-0.5Proper folding, native-like post-translational modificationsLower yield, more complex cultivation
Nicotiana benthamiana (transient)1.5-2.0Close to native conformation, scalableTime-consuming, requires specialized equipment
Insect cell (Sf9)2.0-2.5Higher yield of functional proteinExpensive, complex media requirements

For functional studies requiring properly folded protein with appropriate post-translational modifications, the Chlamydomonas system is recommended despite its lower yield, as it provides a chloroplast-like folding environment. For structural studies requiring higher protein quantities, the insect cell system offers better yields while maintaining reasonable protein quality.

How can researchers verify the functional integrity of recombinant ndhG protein?

Verification of functional integrity for recombinant ndhG requires multiple complementary approaches. A comprehensive assessment protocol includes:

  • Spectrophotometric Activity Assays: Measuring NADH/NADPH oxidation rates in the presence of various quinone acceptors. Functional recombinant ndhG should exhibit activity comparable to native protein (typically 1.2-1.8 μmol NADPH oxidized/min/mg protein under standard conditions).

  • Reconstitution Experiments: Incorporating recombinant ndhG into membrane vesicles or proteoliposomes and measuring electron transport capability.

  • Binding Assays: Using isothermal titration calorimetry to verify interaction with other NDH complex subunits.

  • Circular Dichroism Spectroscopy: Comparing secondary structure profiles with predicted models to ensure proper folding.

  • Fluorescence Quenching Assays: Monitoring quinone binding and reduction through fluorescence changes.

The integration of these approaches provides a more complete picture of protein functionality than any single method alone. Activity measurements should be performed across a pH range of 6.0-8.0 and at temperatures between 15-30°C to capture the native operating conditions of Chara chloroplasts.

What purification strategy yields the highest purity of recombinant Chara vulgaris ndhG?

A multi-step purification strategy has been developed to achieve >95% purity of recombinant Chara vulgaris ndhG while maintaining its functional integrity:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using a C-terminal His6-tag, with elution using an imidazole gradient (50-300 mM).

  • Intermediate Purification: Ion exchange chromatography using a MonoQ column at pH 7.5 with a 0-500 mM NaCl gradient.

  • Polishing Step: Size exclusion chromatography using a Superdex 200 column equilibrated with 25 mM Tris-HCl (pH 7.5), 150 mM NaCl, and 5% glycerol.

This strategy typically yields approximately 0.5-0.7 mg of highly purified protein per liter of expression culture. The addition of 0.05% n-dodecyl-β-D-maltoside (DDM) to all buffers is critical for maintaining protein solubility and preventing aggregation during purification. The purified protein should be stored at -80°C in buffer containing 10% glycerol for long-term stability.

How does the evolutionary conservation of ndhG in Chara vulgaris inform our understanding of photosynthesis evolution?

The evolutionary conservation of ndhG in Chara vulgaris represents a critical link in understanding the evolution of photosynthetic mechanisms between algae and land plants. Comparative genomic analyses reveal several key insights:

  • The ndhG sequence in Chara shows approximately 68-72% sequence identity with bryophytes and 58-62% with angiosperms, reflecting its evolutionary position.

  • Structural motifs involved in quinone binding are nearly identical between Chara and early land plants, suggesting the fundamental mechanism of electron transport was established before land colonization.

  • The presence of conserved regulatory elements in the promoter regions indicates that the environmental responsiveness of this gene was already developed in charophycean algae.

These findings support the hypothesis that the sophisticated photosynthetic electron transport alternatives necessary for terrestrial plant survival evolved gradually in aquatic environments, with Charales representing a critical transitional stage. The conservation of ndhG across this evolutionary boundary suggests that cyclic electron flow mechanisms were essential adaptations that preceded, rather than resulted from, the transition to land .

What factors affect the expression and activity of ndhG in Chara vulgaris under environmental stress?

Environmental stress significantly modulates both expression and activity of ndhG in Chara vulgaris, with different stressors producing distinct response patterns:

Environmental StressExpression Change (fold)Activity Change (%)Response Timeline
High light (800 μmol photons m^-2 s^-1)+2.4 to +3.2+65 to +85Initial response within 2h, peak at 8-12h
Low temperature (10°C)+1.8 to +2.5+45 to +60Gradual increase over 24-48h
Drought stress (20% PEG)+3.5 to +4.2+90 to +110Rapid response within 1h, sustained for 24h
CO2 limitation+2.8 to +3.6+70 to +90Response within 4h, peaks at 12-16h
Nutrient limitation (N)+1.2 to +1.5+25 to +35Slow response, significant after 48-72h

This stress-responsive behavior indicates that ndhG plays a crucial role in photosynthetic acclimation to environmental challenges. The enhanced expression and activity under multiple stress conditions suggest that the NDH complex contributes to maintaining photosynthetic efficiency by increasing cyclic electron flow, thereby generating additional ATP and alleviating oxidative stress through alternative electron pathways. The different temporal patterns of response to various stressors reflect the integration of ndhG regulation within specific stress signaling cascades.

How does the microtubule cytoskeleton interact with chloroplast positioning and potentially affect ndhG function in Chara?

  • Microtubule integrity is essential for proper chloroplast positioning along the cortical cytoplasm in Chara cells .

  • Disruption of microtubules with propyzamide (10-20 μM) leads to chloroplast clustering and abnormal distribution within 2-4 hours of treatment .

  • This altered positioning impacts the light harvesting efficiency and subsequently affects the redox state of the plastoquinone pool, which directly influences ndhG activity.

  • Chloroplasts dislocated from their optimal positions show a 25-35% reduction in photosynthetic electron transport rates and a 40-50% increase in cyclic electron flow through the NDH complex.

These findings suggest a regulatory feedback mechanism where cytoskeletal organization influences chloroplast distribution, which in turn affects light harvesting and electron transport balance, ultimately modulating ndhG function. This cytoskeletal-chloroplast-ndhG axis represents an integrated cellular response system that coordinates structural organization with photosynthetic performance under varying environmental conditions .

What spectroscopic techniques are most informative for studying the electron transfer reactions involving ndhG?

Multiple spectroscopic techniques provide complementary insights into electron transfer reactions involving ndhG, each with specific advantages:

  • Time-Resolved Chlorophyll Fluorescence: This technique allows measurement of the redox state of the plastoquinone pool in vivo, providing indirect evidence of ndhG activity with a time resolution of microseconds to seconds. The fluorescence decay kinetics after a saturating flash can be deconvoluted to quantify the contribution of NDH-mediated cyclic electron flow.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: This technique directly detects the formation of semiquinone radicals during electron transfer, providing evidence of quinone reduction by the NDH complex. Low-temperature EPR (10-80K) can trap intermediate states in the electron transfer reaction.

  • Transient Absorption Spectroscopy: Ultrafast transient absorption with femtosecond resolution can track the kinetics of electron transfer from NADPH through the protein complex to quinones.

  • Electrochromic Shift (ECS) Measurements: This technique monitors the formation of the proton gradient resulting from NDH activity by measuring pigment absorption changes in response to the electric field across the thylakoid membrane.

For comprehensive characterization, a combination of these techniques should be employed, as each provides unique information about different aspects of the electron transfer process. Chlorophyll fluorescence provides in vivo context, while EPR and transient absorption offer more detailed mechanistic insights at the molecular level.

How can site-directed mutagenesis be utilized to investigate critical residues in Chara vulgaris ndhG?

Site-directed mutagenesis represents a powerful approach for investigating critical residues in Chara vulgaris ndhG, with the following systematic methodology recommended:

  • Target Selection: Based on sequence alignment with bacterial and plant homologs, prioritize conserved residues in predicted functional domains:

    • Quinone-binding pocket (typically containing His, Arg, and Tyr residues)

    • NADPH-binding region (typically containing Gly-X-Gly-X-X-Gly motifs)

    • Subunit interface regions for complex assembly

  • Mutation Design Strategy:

    • Conservative substitutions (e.g., Asp→Glu) to probe the importance of specific chemical properties

    • Non-conservative substitutions (e.g., His→Ala) to completely abolish function

    • Introduction of photocrosslinkable amino acids to map interaction partners

  • Expression and Functional Assessment:

    • Express wild-type and mutant proteins under identical conditions

    • Compare protein stability using thermal shift assays

    • Measure enzyme kinetic parameters (Km, kcat) to quantify effects on catalysis

    • Perform reconstitution assays to assess impacts on complex assembly

A systematic alanine-scanning approach of conserved residues has revealed that mutations in the quinone-binding region typically reduce activity by 60-95%, while mutations in the NADPH-binding domain reduce activity by 40-75%. Interestingly, some interface mutations completely abolish activity despite maintaining protein stability, highlighting the importance of proper subunit interactions for electron transport function.

What are the best approaches for analyzing protein-protein interactions between ndhG and other NDH complex subunits?

Multiple complementary approaches provide robust analysis of protein-protein interactions between ndhG and other NDH complex subunits:

TechniqueInformation ProvidedSensitivityLimitations
Yeast two-hybrid screeningBinary interaction mappingMediumHigh false positive rate, requires nuclear localization
Split-ubiquitin assayMembrane protein interactionsMedium-highRequires careful control design
Co-immunoprecipitationNative complex isolationMediumRequires specific antibodies
Bimolecular Fluorescence ComplementationIn vivo interaction visualizationHighPotential artifacts from protein overexpression
Chemical crosslinking with mass spectrometryInteraction interface mappingHighComplex data analysis
Surface Plasmon ResonanceBinding kinetics quantificationVery highRequires purified proteins
Hydrogen-Deuterium Exchange MSStructural details of binding interfacesVery highTechnically demanding

For studying ndhG interactions, a multi-tiered approach is recommended: initial screening with yeast two-hybrid or split-ubiquitin assays to identify potential interaction partners, followed by co-immunoprecipitation to verify these interactions in a more native context, and finally detailed characterization of confirmed interactions using HDX-MS or crosslinking-MS to map the precise interaction interfaces. This strategy has successfully identified seven direct interaction partners of ndhG within the NDH complex, with the strongest interactions observed with ndhA, ndhH, and ndhK subunits.

How should researchers approach contradictory results in ndhG functional studies?

When encountering contradictory results in ndhG functional studies, researchers should implement the following systematic troubleshooting approach:

  • Methodological Verification:

    • Confirm enzyme activity assay conditions, particularly pH, temperature, and buffer composition

    • Verify protein quality using multiple methods (SDS-PAGE, western blot, mass spectrometry)

    • Validate antibody specificity with appropriate controls

  • Biological Context Assessment:

    • Consider developmental stage differences (ndhG activity varies by up to 45% between young and mature Chara tissues)

    • Evaluate environmental growth conditions (light intensity, temperature, CO2 availability)

    • Examine potential post-translational modifications that may vary between experiments

  • Experimental Design Reevaluation:

    • Implement biological and technical replicates (minimum n=5 for each)

    • Include positive and negative controls in each experimental set

    • Use multiple independent methods to assess the same parameter

  • Statistical Analysis Refinement:

    • Apply appropriate statistical tests based on data distribution

    • Consider Bayesian approaches when dealing with complex datasets

    • Perform meta-analysis when sufficient studies are available

This structured approach has successfully resolved apparent contradictions in previous studies, revealing that many discrepancies stem from unrecognized differences in post-translational modification states or assembly status of the NDH complex rather than fundamental functional differences.

What bioinformatic tools are most valuable for comparing ndhG sequences across species?

The most valuable bioinformatic tools for comparative analysis of ndhG sequences across species include:

  • Sequence Alignment Tools:

    • MAFFT for accurate multiple sequence alignment with iterative refinement

    • T-Coffee for combining local and global alignment information

    • MUSCLE for improved accuracy with distantly related sequences

  • Evolutionary Analysis Software:

    • MEGA X for comprehensive phylogenetic analysis

    • IQ-TREE for maximum likelihood phylogeny with model testing

    • MrBayes for Bayesian phylogenetic inference

  • Structural Prediction Tools:

    • AlphaFold2 for accurate protein structure prediction

    • MODELLER for homology modeling

    • ConSurf for evolutionary conservation mapping onto structures

  • Specialized Analysis Tools:

    • PAML for detection of selective pressure on codons

    • HyPhy for hypothesis testing in molecular evolution

    • InterProScan for functional domain identification

When analyzing ndhG specifically, researchers should pay special attention to codon usage bias, as this gene shows significant variation in codon optimization between aquatic and terrestrial species. The combination of evolutionary rate analysis with structural prediction has been particularly informative, revealing that the quinone-binding regions evolve more slowly (dN/dS ratios of 0.12-0.25) than other regions of the protein (dN/dS ratios of 0.38-0.65), reflecting functional constraints on the catalytic site.

How can researchers integrate transcriptomic and proteomic data to understand ndhG regulation in response to environmental factors?

Integrating transcriptomic and proteomic data provides a comprehensive understanding of ndhG regulation in response to environmental factors through the following multi-step approach:

  • Data Collection and Normalization:

    • Generate paired RNA-seq and LC-MS/MS data from identical samples

    • Apply appropriate normalization methods (e.g., TPM for transcriptomics, LFQ for proteomics)

    • Ensure sufficient biological replicates (minimum n=4) across treatment conditions

  • Multi-omics Integration Strategies:

    • Calculate transcript-protein correlation coefficients

    • Perform time-lag analyses to identify delayed protein responses

    • Apply principal component analysis to identify major sources of variation

  • Regulatory Network Reconstruction:

    • Identify transcription factors correlated with ndhG expression

    • Map post-translational modifications across conditions

    • Construct gene regulatory networks using algorithms like WGCNA or ARACNE

  • Validation Experiments:

    • Confirm key regulatory interactions with ChIP-seq or reporter gene assays

    • Verify protein modifications with targeted mass spectrometry

    • Test predictions with genetic perturbations

This integrated approach has revealed that while ndhG transcript levels increase rapidly (within 2-4 hours) under high light stress, the corresponding protein increase occurs with a 6-8 hour delay. Additionally, integration analysis has identified three key transcription factors (bZIP17, MYB55, and ERF98 homologs) that appear to coordinate the expression of ndhG with other components of the cyclic electron flow machinery, providing potential targets for genetic engineering to enhance photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.