Recombinant Chara vulgaris Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
ycf4
Target Protein Sequence
MKIKPCKSQVFRLEPIIGSRKYINYFWSFSIFFGAFGFLIVGICSYLKKELFFFSAENII FIPQGAVMCFYGIAGIFLSFYLWFTMILGVGSGFNEFNKNEGIVNIFRWGFPGQNRRIKI CCLIKDIKSIRIYIRDGISPRSALYLKIRGMPDIPLDVIEDRFNLNEIEKRATELASFLR VPIEGLE
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what is its fundamental role in photosynthesis?

Ycf4 (hypothetical chloroplast open reading frame 4) is a thylakoid protein essential for the assembly and accumulation of photosystem I (PSI) complex, a crucial component of the photosynthetic apparatus. Studies have demonstrated that Ycf4 functions as a scaffold for PSI assembly, facilitating the proper integration of various PSI subunits into a functional complex .

The protein is encoded by the chloroplast genome and is part of a polycistronic transcriptional unit in most species. In Chlamydomonas reinhardtii, for example, ycf4 is co-transcribed with rps9, ycf3, and rps18 genes . Knockout studies have conclusively shown that in the absence of Ycf4, photosystem I fails to accumulate properly, leading to deficiencies in photosynthetic performance .

How conserved is Ycf4 across different photosynthetic organisms?

Ycf4 displays varying degrees of sequence conservation across different photosynthetic organisms:

Species ComparisonSequence Identity (%)Notes
Within Lathyrus genusAs low as 31%Highly variable within this genus
Ycf4 homologs from algae, land plants, and cyanobacteria41-52%Moderate conservation
Tobacco and Synechocystis (cyanobacterium)45%Higher than within some plant genera
Ycf3 homologs from algae, land plants, and cyanobacteria64-78%More conserved than Ycf4

Interestingly, the ycf4 gene in some legume species (Lathyrus) shows an exceptionally high mutation rate, making it more divergent within this single genus than between distantly related organisms such as angiosperms and cyanobacteria . This phenomenon represents an unusual case of localized hypermutation in the chloroplast genome.

What methods are most effective for studying Ycf4 function in vivo?

Several methodological approaches have proven valuable for investigating Ycf4 function:

  • Chloroplast Transformation and Gene Disruption: Biolistic transformation has been successfully used to disrupt ycf4 with a chloroplast selectable marker cassette in model organisms like Chlamydomonas reinhardtii . This technique allows for precise genetic manipulation of the chloroplast genome and subsequent phenotype analysis.

  • Tandem Affinity Purification (TAP) Tagging: This approach has been particularly effective for isolating Ycf4-containing complexes. Research has shown that C-terminal TAP-tagging of Ycf4 does not significantly affect its function or structure, making this a reliable method for purification and characterization .

  • Biochemical Purification Protocol:

    • Solubilization of thylakoid membranes with dodecyl maltoside (DDM)

    • Overnight adsorption to IgG agarose at 4°C in a rotating column

    • Subsequent ion exchange column chromatography

    • Sucrose gradient ultracentrifugation for final purification

  • Pulse-Chase Protein Labeling: This technique has revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, providing insights into the assembly process .

  • Transmission Electron Microscopy and Single Particle Analysis: These techniques have been used to visualize the purified Ycf4-containing complex, revealing particles measuring approximately 285 × 185 Å .

What is the composition and structure of the Ycf4-containing complex?

The Ycf4-containing complex in Chlamydomonas reinhardtii has been extensively characterized:

PropertyDetailsReference
Size>1500 kD
Dimensions285 × 185 Å (largest structures)
PSI subunitsPsaA, PsaB, PsaC, PsaD, PsaE, PsaF
Associated proteinsCOP2 (opsin-related protein)
Identification methodsMass spectrometry (LC-MS/MS), immunoblotting

The complex appears to exist in several large oligomeric states, as revealed by electron microscopy. Almost all Ycf4 and COP2 in wild-type cells co-purify during sucrose gradient ultracentrifugation and ion exchange chromatography, indicating an intimate and exclusive association between these two proteins .

Experimental evidence suggests that this complex acts as a scaffold for PSI assembly, with the PSI polypeptides found in association with it being newly synthesized and partially assembled into a pigment-containing subcomplex .

How does the function of Ycf4 differ between green algae and higher plants?

A significant functional difference exists between Ycf4 in green algae and higher plants:

OrganismEffect of ycf4 KnockoutPhenotypeReference
Chlamydomonas reinhardtii (green alga)Complete loss of PSIUnable to grow photoautotrophically
Nicotiana tabacum (tobacco)Reduced PSI accumulationSeverely affected photosynthetic performance but capable of photoautotrophic growth
CyanobacteriaReduced but not eliminated PSI assemblyImpaired but not lethal

This differential requirement suggests evolutionary changes in the photosynthetic apparatus assembly pathways. In higher plants, alternative or redundant mechanisms for PSI assembly may exist, whereas in Chlamydomonas, Ycf4 appears to be absolutely essential .

Biochemical analyses in tobacco suggest that Ycf4 acts post-translationally in the PSI assembly process. Additionally, with increasing leaf age, the contents of Ycf4 and Y3IP1 (another auxiliary factor involved in PSI assembly) decrease strongly, while PSI levels remain constant. This suggests that PSI is highly stable once assembled and that its biogenesis is primarily restricted to young leaves in higher plants .

What is the relationship between Ycf4 and COP2, and how does this impact PSI assembly?

The opsin-related protein COP2 shows a remarkably close association with Ycf4:

  • Co-purification: Almost all Ycf4 and COP2 in wild-type Chlamydomonas cells co-purify during biochemical isolation procedures, indicating an intimate and exclusive association .

  • Functional relationship: RNA interference experiments reducing COP2 to 10% of wild-type levels increased the salt sensitivity of the Ycf4 complex stability but did not affect the accumulation of PSI. This suggests that while COP2 contributes to the stability of the Ycf4 complex, it is not essential for PSI assembly .

  • Methodological approach to study the relationship:

    • RNA interference targeting COP2

    • Quantification of complex stability under varying salt conditions

    • Measurement of PSI accumulation through spectroscopic and immunoblotting techniques

These findings suggest that COP2 may play a structural or stabilizing role in the Ycf4 complex rather than a direct functional role in PSI assembly.

What are the implications of the hypermutation observed in the ycf4 region of some species?

The ycf4 region in some legume species, particularly within the Lathyrus genus, represents a dramatic hotspot for point mutations:

  • Magnitude of mutation rate increase: The mutation rate in this region is at least 20-fold higher than the rest of the chloroplast genome, as indicated by comparisons of synonymous site divergence .

  • Evolutionary consequences: Despite the high mutation rate, ycf4 remains functional in species that retain it, as evidenced by selection analysis showing dN/dS ratios less than 1 (indicating purifying selection) .

  • Sequence divergence comparison:

    ComparisonSequence IdentityEvolutionary Distance
    Between L. palustris and L. cirrhosus31%<10 million years
    Between tobacco and Synechocystis45%>1 billion years
  • Associated phenomena: The region also shows high rates of formation and turnover of minisatellite-like sequences in Lathyrus, with species-specific tandem repeats that suggest high sequence turnover .

  • Methodological implications for research: This extreme localized mutation rate challenges the common assumption that point mutation rates are approximately constant across a genome, which underpins the silent molecular clock hypothesis. Researchers studying molecular evolution in chloroplast genomes should be aware of this phenomenon when interpreting sequence divergence data .

How can recombinant Chara vulgaris Ycf4 be effectively used in experimental studies?

Recombinant Chara vulgaris Ycf4 provides valuable opportunities for experimental studies:

  • Protein-Protein Interaction Studies: The recombinant protein can be used in pull-down assays, yeast two-hybrid experiments, or surface plasmon resonance to identify and characterize interactions with PSI subunits and other assembly factors.

  • Structural Analysis Protocol:

    • Express and purify recombinant Ycf4 under native conditions

    • Perform crystallization trials for X-ray crystallography

    • Alternatively, use cryo-electron microscopy to resolve the structure

    • Compare with photosystem I super-complex structures (2.8 Å resolution structures are available)

  • Cross-Species Complementation Studies: The recombinant protein can be used in complementation assays with ycf4-deficient mutants from other species to assess functional conservation and specificity.

  • Storage and Handling Recommendations:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Antibody Production: The recombinant protein can serve as an antigen for generating specific antibodies for immunolocalization and Western blot analysis of Ycf4 in various species and experimental conditions.

What techniques have been most informative in elucidating Ycf4 function?

Multiple complementary techniques have contributed to our understanding of Ycf4:

TechniqueApplicationKey FindingsReference
Gene disruption via biolistic transformationFunctional analysisYcf4 is essential for PSI accumulation in C. reinhardtii
Western blot analysisProtein accumulationPSI complex does not accumulate stably in thylakoid membranes of ycf4-deficient transformants
RNA blot hybridizationsTranscript analysisTranscripts of psaA, psaB, and psaC accumulate normally in ycf4 mutants
Chimeric reporter genesTranslation analysisYcf3 is not required for initiation of translation of psaA and psaB mRNA
TAP taggingComplex purificationIdentified >1500 kD Ycf4-containing complex with PSI subunits
Mass spectrometryProtein identificationIdentified COP2 and PSI subunits in the Ycf4 complex
Electron microscopyStructural analysisRevealed particles measuring 285 × 185 Å
Pulse-chase protein labelingAssembly kineticsPSI polypeptides in Ycf4 complex are newly synthesized

How can researchers distinguish between Ycf4 and other chloroplast assembly factors?

To distinguish Ycf4 from other assembly factors like Ycf3 and BtpA:

  • Sequence Analysis:

    • Ycf4 shows 41-52% sequence identity among homologs from algae, land plants, and cyanobacteria

    • Ycf3 shows higher conservation (64-78% identity) among the same groups

    • Protein domain analysis can identify the distinct Ycf4 protein domain (Pfam: PF02392, InterPro: IPR003359)

  • Functional Analysis Protocol:

    • Generate specific knockout mutants for each factor

    • Compare photosynthetic phenotypes using oxygen evolution measurements

    • Analyze PSI assembly using blue native PAGE followed by immunoblotting

    • Conduct complementation tests to confirm specificity

  • Localization Studies:

    • While both Ycf3 and Ycf4 are associated with thylakoid membranes, they show distinct patterns in fractionation experiments

    • Neither is stably associated with the mature PSI complex

    • Both are extrinsic membrane proteins that can be removed by alkali or chaotropic agent treatment

What indel markers can be used to identify ycf4 regions in related species?

The ycf4-cemA region has proven useful for developing indel markers to distinguish between closely related species:

  • Case Study: Distinguishing Angelica polymorpha and Ligusticum officinale

    • A. polymorpha carries a 418 bp deletion in the ycf4-cemA region compared to L. officinale

    • Sequence-specific primers designed in conserved regions flanking ycf4 and cemA successfully amplified sequences from both species

    • 21 accessions collected from different sites were clearly distinguished using these markers

  • Methodology for Indel Marker Development:

    • Perform comparative analysis of chloroplast genomes to identify regions with high Pi (nucleotide diversity) values

    • The ycf4-cemA region often shows high divergence (Pi of 0.189 in some species)

    • Design primers in conserved flanking regions

    • Test primers on samples from different populations or closely related species

    • Validate by sequencing to confirm species-specific patterns

  • Applications: These markers are particularly useful for:

    • Species identification in botany and ecology

    • Authentication of medicinal plants

    • Evolutionary studies of closely related species

    • Phylogeographic analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.