Recombinant Chara vulgaris Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Chara vulgaris Photosystem II (PSII) CP47 chlorophyll apoprotein (psbB) is a heterologously expressed protein derived from the green alga Chara vulgaris. CP47 is a core antenna chlorophyll-binding subunit of PSII, critical for light energy harvesting and electron transfer to the reaction center. This recombinant form enables structural, functional, and biochemical studies of PSII, particularly in understanding chlorophyll-protein interactions and PSII assembly .

Functional Role

CP47 serves as a bridge between the outer light-harvesting complexes (LHCII) and the PSII core. Key functions include:

  • Energy Transfer: Channels excitation energy from peripheral chlorophylls to the reaction center .

  • Stability: Supports assembly of the oxygen-evolving enhancer (OEE) proteins and PsbH subunit .

Production Overview

The Chara vulgaris psbB gene is expressed in mammalian cells, yielding a partial-length recombinant protein:

ParameterDetailSource
Expression HostMammalian cells
Purity>85% (SDS-PAGE)
Storage Conditions-20°C/-80°C (liquid: 6 months; lyophilized: 12 months)
UniProt IDQ1ACH5

Comparative Analysis with Other Recombinant CP47 Variants

SpeciesSourceTagProtein LengthPurityUniProt ID
Chara vulgarisMammalian cellsN/A*Partial>85%Q1ACH5
Spinacia oleracea (Spinach)E. coliHisFull (1–508 aa)>90%P04160
Oenothera glaziovianaE. coliHisFull (1–508 aa)>90%B0Z570

*Tag type not specified in Chara vulgaris product documentation .

Key Research Insights

  1. Chlorophyll Binding and Ligand Interaction:

    • Histidine residues at positions 12, 17, 22, 27, and 32 directly coordinate chlorophyll magnesium ions, while others stabilize chlorophylls through proximity .

    • Structural models predict five chlorophylls with Mg–His bonds and nine with indirect interactions .

  2. PSII Assembly and Regulation:

    • CP47 recruitment depends on successful assembly of D1/D2 heterodimers .

    • RNA-binding proteins like HCF107 (Arabidopsis) and Mbb1 (Chlamydomonas) regulate psbB and psbH transcript processing, ensuring proper translation .

  3. Functional Interactions:

    • CP47 interacts with PsbH (phosphoprotein) and PsbT (4 kDa chloroplast-encoded subunit), stabilizing the QB-binding site and regulating electron transport .

Applications

  • Structural Biology: Recombinant CP47 aids in refining atomic-resolution models of PSII via cryo-EM and X-ray crystallography .

  • Biotechnology: Chloroplast-based systems (e.g., Chlamydomonas) leverage psbB promoters for heterologous protein production, though Chara vulgaris variants are less documented .

Challenges and Future Directions

  • Partial-Length Limitations: The Chara vulgaris recombinant protein lacks full-length structure, potentially limiting studies on peripheral chlorophyll interactions .

  • Post-Translational Modifications: Phosphorylation of PsbH and interactions with PsbT in Chara vulgaris remain understudied .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag preference, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Chara vulgaris (Common stonewort)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHIMHTALVSGWAGSMALYELAVFDPSDPILDPMWRQGM FVIPFMTRLGITKSWGGWSITGETITNPGIWSYEGVAAVHIILSGLLFLAAIWHWVYWDL ELFRDERTGKPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLFGPGIWISDPYGITGKVQS VSPAWGAEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFFAAFIVSGTMWYGSAATPIELFGPTRYQWDQGYFQQEIDRRVRLSTSQGFSISE AWSRIPEKLAFYDYIGNNPAKGGLFRAGPMDNGDGIAVGWLGHAVFKDKEGHELFVRRMP TFFETFPVVLVDEEGIIRADLPFRRAESKYSIEQVGVTVEFYGGELDNVSFSDPATVKKY ARRAQLGEIFEFDRTTLKSDGVFRSSPRGWFTFGHLCFALLFFFGHIWHGARTLFRDVFA GIDPDIDSQIEFGIFQKLGDPTTKKQTV
Uniprot No.

Target Background

Function
CP47, a chlorophyll-binding protein, is a crucial component of the photosystem II (PSII) core complex. It plays a vital role in catalyzing the primary light-induced photochemical reactions of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient that subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CP47 (psbB) protein and what is its role in Photosystem II?

CP47 is an internal antenna protein of Photosystem II (PSII) with a molecular weight of approximately 56 kDa . It functions primarily as a core chlorophyll-binding protein that facilitates light harvesting and energy transfer to the reaction center. CP47 plays a critical role in the structural organization of PSII and contributes to the efficiency of light capture during photosynthesis. In Chara vulgaris, as in other photosynthetic organisms, CP47 is encoded by the chloroplast psbB gene and forms part of the core complex of PSII along with other proteins including D1 (psbA) and D2 (psbD).

What conserved domains and motifs are present in CP47 across different species?

The CP47 protein contains several highly conserved transmembrane helices and chlorophyll-binding domains that are preserved across diverse photosynthetic organisms. These conserved regions are essential for proper protein folding, chlorophyll binding, and interactions with other PSII subunits. While the search results don't specifically detail CP47 conserved motifs, we can infer from studies of other photosystem proteins that these conserved domains are crucial for maintaining functional integrity. Researchers working with Chara vulgaris CP47 should expect similar conservation patterns to those observed in other species, with potential unique adaptations reflecting the evolutionary position of charophyte algae.

How does the CP47 protein interact with other components of Photosystem II?

CP47 forms extensive interactions with other core components of PSII, particularly the D1 and D2 proteins that comprise the reaction center. These interactions are critical for maintaining the structural integrity of PSII and for efficient energy transfer from the light-harvesting antenna to the reaction center. CP47 also interacts with various small subunits of PSII and likely participates in the coordination of the oxygen-evolving complex. In research contexts, understanding these protein-protein interactions is essential when designing recombinant expression systems to ensure proper folding and function of the isolated CP47 protein.

What expression systems are most effective for recombinant production of CP47 from Chara vulgaris?

For recombinant production of CP47 from Chara vulgaris, several expression systems may be considered, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Conditions
E. coliHigh yield, simple cultivation, genetic tractabilityPotential improper folding, lack of chlorophyll incorporationIPTG induction at 18°C, fusion with solubility tags
CyanobacteriaNative-like environment, chlorophyll incorporationLower yield, longer growth timePhotosynthetic conditions, temperature 25-30°C
Green algaeSimilar biochemical environment to CharaChallenging transformation protocolsSpecies-specific optimization required
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, potential scaling challengesSupplementation with chlorophyll and membrane components

Researchers should carefully consider the downstream applications when selecting an expression system. For structural studies requiring chlorophyll incorporation, photosynthetic hosts like cyanobacteria might be preferable despite lower yields.

What strategies can overcome challenges in obtaining correctly folded recombinant CP47?

Obtaining correctly folded recombinant CP47 presents significant challenges due to its multiple transmembrane domains and cofactor requirements. Effective strategies include:

  • Co-expression with chaperone proteins to assist proper folding

  • Fusion with solubility-enhancing tags (e.g., MBP, SUMO) that can be subsequently cleaved

  • Membrane-mimetic expression conditions using detergents or artificial membrane systems

  • Expression at reduced temperatures (16-20°C) to slow protein production and allow correct folding

  • Co-expression with other PSII components that may stabilize CP47 structure

For membrane proteins like CP47, incorporation into nanodiscs or liposomes during or after purification can help maintain native-like conformation and function. The presence of chlorophyll during expression and purification processes is also critical for proper folding of this chlorophyll-binding protein.

How can researchers effectively isolate intact PSII complexes containing native CP47 from Chara vulgaris?

For isolation of intact PSII complexes with native CP47 from Chara vulgaris:

  • Harvest and gently disrupt Chara vulgaris cells using a buffer containing osmotic protectants and protease inhibitors

  • Perform differential centrifugation to isolate thylakoid membranes

  • Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (β-DDM) or digitonin

  • Separate protein complexes using density gradient centrifugation or column chromatography

  • Verify complex integrity using clear-native PAGE (CN-PAGE), where a 1:10,000 dilution of anti-PsbB antibody can be used for detection

The isolation procedure should be performed under dim green light and at 4°C to minimize photodamage and proteolytic degradation. Researchers should verify the composition of isolated complexes using Western blot with antibodies against CP47 and other PSII components.

What antibodies and detection methods are most effective for studying CP47 in different experimental contexts?

For CP47 detection and characterization, several approaches have demonstrated effectiveness:

MethodApplicationSensitivityRecommended Parameters
Western BlotProtein expression analysisHighAnti-PsbB antibody at 1:2000 dilution
Clear-native PAGEIntact complex analysisModerateAnti-PsbB antibody at 1:10,000 dilution
Immunogold EMLocalization studiesHighSecondary gold-conjugated antibodies
Mass SpectrometryProtein identificationVery highTryptic digestion, LC-MS/MS analysis
Fluorescence MicroscopyIn vivo localizationModerateGFP fusion proteins or immunofluorescence

The polyclonal rabbit antibody against PsbB described in search result shows broad reactivity across different photosynthetic organisms, including algae, making it suitable for Chara vulgaris research. This antibody recognizes a conserved epitope derived from sequences including Arabidopsis thaliana AtCg00680, Hordeum vulgare P10900, Oryza sativa P0C364, and Synechocystis PCC 6803 P05429 .

How can researchers assess the functional integrity of recombinant CP47 protein?

Assessing functional integrity of recombinant CP47 is critical for ensuring experimental validity. Methods include:

  • Spectroscopic analysis: Absorption and fluorescence spectroscopy to verify chlorophyll binding and energy transfer capabilities

  • Circular dichroism (CD) spectroscopy to evaluate secondary structure

  • Reconstitution assays with other PSII components to test ability to form functional complexes

  • Oxygen evolution measurements when CP47 is incorporated into PSII complexes

  • Thermal stability assays to compare with native protein

Functional CP47 should display characteristic absorbance peaks corresponding to bound chlorophyll molecules and demonstrate the ability to transfer excitation energy when incorporated into larger PSII assemblies.

What techniques are available for studying CP47-chlorophyll interactions in recombinant proteins?

To investigate CP47-chlorophyll interactions in recombinant systems:

  • Time-resolved fluorescence spectroscopy to measure energy transfer kinetics

  • Site-directed mutagenesis of putative chlorophyll-binding residues followed by spectroscopic analysis

  • Resonance Raman spectroscopy to probe chlorophyll environments

  • Single-molecule spectroscopy to detect conformational dynamics

  • Differential scanning calorimetry to measure stabilization effects of chlorophyll binding

How can researchers investigate the role of CP47 in photoprotection mechanisms?

To study CP47's role in photoprotection:

  • Generate site-directed mutants affecting residues potentially involved in non-photochemical quenching

  • Perform high-light exposure experiments with wild-type and mutant CP47 in reconstituted systems

  • Measure reactive oxygen species production using fluorescent probes

  • Analyze energy-dependent quenching (qE) in systems with modified CP47

  • Compare thermal dissipation capacities between wild-type and mutant proteins

Advanced pulse amplitude modulation (PAM) fluorometry can be used to assess non-photochemical quenching parameters in systems with modified CP47, providing insights into its role in dissipating excess excitation energy under high-light conditions.

What approaches can be used to study the assembly dynamics of CP47 into functional PSII complexes?

For investigating CP47 assembly dynamics:

  • Pulse-chase experiments with isotopically labeled amino acids to track newly synthesized CP47

  • Time-resolved cryo-electron microscopy to capture assembly intermediates

  • Co-immunoprecipitation with antibodies against CP47 to identify interaction partners during assembly

  • In vitro reconstitution assays with purified components added in different sequences

  • Genetic approaches using conditional mutants to arrest assembly at specific stages

These techniques can reveal the kinetics and ordered steps of PSII assembly, with particular focus on when and how CP47 is incorporated into the growing complex.

How do post-translational modifications affect CP47 function and stability?

Post-translational modifications (PTMs) can significantly influence CP47 function and stability. Research approaches include:

  • Mass spectrometry to identify and quantify PTMs including phosphorylation, oxidation, and glycosylation

  • Site-directed mutagenesis to mimic or prevent specific modifications

  • In vitro enzymatic assays to determine effects of specific PTMs on protein properties

  • Comparative analysis of PTM patterns under different environmental stresses

  • Structural studies to determine how PTMs affect protein conformation

A comprehensive PTM analysis can provide insights into how CP47 function is regulated in response to changing environmental conditions and developmental stages.

How has the psbB gene evolved across different photosynthetic lineages?

The psbB gene has maintained significant conservation across photosynthetic organisms due to its essential role in PSII function. Evolutionary analysis suggests:

  • The core structure and function of CP47 have been conserved from cyanobacteria to land plants

  • The psbB gene is retained in the chloroplast genome across diverse photosynthetic lineages

  • Unlike some photosystem genes that have been lost in specific lineages (e.g., PsaM in angiosperms) , psbB appears to be universally conserved in oxygenic photosynthetic organisms

  • Sequence analysis suggests that CP47 evolved from multiple common ancestral nodes, similar to other photosystem proteins

This high degree of conservation reflects the critical role of CP47 in PSII function and the constraints on its evolution imposed by its interactions with other PSII components and its chlorophyll-binding requirements.

What are the key differences in CP47 structure and function between Chara vulgaris and other photosynthetic organisms?

While specific data on Chara vulgaris CP47 is limited in the search results, comparative analysis between charophyte algae and other photosynthetic organisms might reveal:

  • Potential adaptations in CP47 that reflect Chara's freshwater habitat and growth conditions

  • Differences in chlorophyll-binding sites that might affect spectral properties and energy transfer efficiency

  • Variations in protein-protein interaction domains that could influence PSII supercomplex formation

  • Unique regulatory features that may have evolved in the charophyte lineage

These differences would be particularly interesting from an evolutionary perspective, as Chara vulgaris represents a lineage closely related to the ancestors of land plants.

How do genomic rearrangements and recombination events affect psbB gene expression and function?

Genomic rearrangements and recombination can significantly impact chloroplast gene expression, including psbB:

  • The chloroplast genome has undergone vivid recombination across different lineages, potentially affecting gene arrangement and expression

  • Inverted repeats (IR) in the chloroplast genome stabilize genome structure, and loss of these regions can lead to genetic rearrangements

  • Such rearrangements may affect the positioning of regulatory elements controlling psbB expression

  • Changes in gene order may influence co-transcription of psbB with adjacent genes

Researchers studying psbB expression should consider these genomic contexts, as they may explain variations in expression levels and regulatory mechanisms across different species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.