Recombinant Cheirogaleus medius Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Cheirogaleus medius (Fat-tailed dwarf lemur)
Target Names
Target Protein Sequence
MACPVQLGFQDAASPIMEELTYFHDHTLMIVFLISSLVLYIISLMLTTELTHTSTMDAQE VETVWTILPAVILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYENLCFDS YMTPSSDLKPGELRLLEVDNRVVLPTEMSIRMLISSEDVLHSWTVPSLGVKTDAIPGRLN QATLMTSRPGIYYGQCSEICGANHSFMPIVLELVPLKHFEEWLLAML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme is crucial for oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cheirogaleus medius MT-CO2 and why is it significant for research?

Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially encoded protein that forms an essential component of the respiratory chain complex IV. In Cheirogaleus medius (fat-tailed dwarf lemur), this protein has gained significance for both evolutionary studies and conservation genomics. The recombinant form provides researchers with standardized material for comparative analyses across cheirogaleid primates and other taxonomic groups. MT-CO2 is particularly valuable because it evolves at a rate suitable for differentiating between closely related species and populations, making it an excellent marker for phylogenetic studies and conservation assessments of the endangered Malagasy lemurs .

How does C. medius MT-CO2 compare with this protein in other lemur species?

The MT-CO2 gene has been utilized extensively in conservation genomic analyses across lemur species. Research indicates that while the protein maintains its functional domains across Cheirogaleidae family members, there are sufficient sequence variations to enable phylogenetic differentiation. Comparative studies using cytochrome c oxidase subunit II sequencing have revealed evolutionary relationships and ancient introgression events among dwarf lemur populations . These analyses have helped resolve taxonomic uncertainties within the Cheirogaleus genus and identified unique conservation units, particularly valuable for the management of these endangered primates endemic to Madagascar.

What are the optimal conditions for reconstitution and storage of recombinant C. medius MT-CO2?

For optimal reconstitution of lyophilized recombinant C. medius MT-CO2:

  • Centrifuge the vial briefly before opening to collect the powder at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term stability

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C or preferably -80°C

Research indicates that repeated freeze-thaw cycles significantly reduce protein activity, with each cycle potentially decreasing activity by 10-15%. Therefore, creating single-use aliquots is strongly recommended for reproducible experimental results.

How should I design experimental controls when working with recombinant C. medius MT-CO2?

When designing experiments with recombinant C. medius MT-CO2, include these essential controls:

  • Negative controls:

    • Buffer-only samples without recombinant protein

    • Non-relevant recombinant protein with similar tag and production system

  • Positive controls:

    • Commercial cytochrome c oxidase preparations from related species

    • Previously validated batch of the recombinant protein

  • Tag-specific controls:

    • Recombinant protein with the same tag but different insert

    • Anti-His antibody validation tests

  • Species-specific controls:

    • When possible, native protein isolated from C. medius tissue samples

    • Recombinant MT-CO2 from closely related species (e.g., other Cheirogaleidae)

These controls help distinguish protein-specific effects from artifacts related to the recombinant nature, expression system, or tag presence.

What experimental approaches can verify the functional activity of recombinant C. medius MT-CO2?

To verify functional activity of recombinant C. medius MT-CO2:

  • Enzymatic activity assays:

    • Cytochrome c oxidation assay measuring electron transfer rate

    • Oxygen consumption measurements using polarographic methods

  • Structural confirmation:

    • Circular dichroism spectroscopy to verify secondary structure

    • Thermal shift assays to assess protein stability

  • Binding assays:

    • Surface plasmon resonance with known interaction partners

    • Co-immunoprecipitation studies with other respiratory complex components

  • Comparative analyses:

    • Activity comparison with native protein (when available)

    • Functional complementation in COX2-deficient cellular models

The recombinant protein should exhibit electron transfer capability comparable to native MT-CO2 when properly folded, although the His-tag may slightly modify kinetic parameters.

How can recombinant C. medius MT-CO2 be used in hibernation research?

C. medius (fat-tailed dwarf lemur) is one of the few primates capable of hibernation, making its mitochondrial proteins particularly valuable for hibernation research. During the dry season, these lemurs enter a state of torpor in tree holes throughout western Madagascar . Researchers can use recombinant MT-CO2 to investigate:

  • Metabolic adaptation mechanisms:

    • Compare binding affinities and electron transfer rates at different temperatures

    • Assess structural stability under conditions mimicking hibernation

  • Post-translational modifications:

    • Identify hibernation-specific modifications by comparing with protein isolated during active and torpor states

    • Map modification sites using mass spectrometry and recombinant protein as a reference

  • Comparative studies:

    • Analyze functional differences between MT-CO2 from hibernating (C. medius) and non-hibernating lemurs

    • Investigate species-specific adaptations in mitochondrial respiration during metabolic depression

This research contributes to understanding the unique physiological adaptations that allow C. medius to survive seasonal resource scarcity through metabolic depression .

What approaches can resolve data contradictions in phylogenetic analyses using MT-CO2?

MT-CO2 sequence data occasionally produces phylogenetic results that contradict other genetic markers, potentially indicating ancient introgression events. To resolve these contradictions:

  • Multi-locus approach:

    • Compare MT-CO2-based phylogenies with nuclear markers

    • Implement Bayesian concordance analysis to identify discordant signals

  • Advanced phylogenetic methods:

    • Apply coalescent-based species tree methods that account for incomplete lineage sorting

    • Implement network-based phylogenetic approaches for reticulate evolution visualization

  • Dating analysis:

    • Calibrate molecular clocks using fossil data and recombinant protein for rate verification

    • Estimate divergence times and potential introgression periods

  • Population genetic analyses:

    • Test for signatures of selection using McDonald-Kreitman tests

    • Apply ABBA-BABA tests to detect introgression

These approaches have successfully resolved phylogenetic discrepancies within the Cheirogaleus genus, revealing ancient introgression events that explain contradictory signals between mitochondrial and nuclear markers.

How can recombinant C. medius MT-CO2 contribute to ecological niche modeling?

While primarily a molecular tool, recombinant C. medius MT-CO2 can contribute valuable data to ecological niche modeling through:

  • Genetic diversity mapping:

    • Use MT-CO2 sequence variation as a proxy for population genetic diversity

    • Correlate genetic diversity patterns with ecological variables across habitats

  • Adaptation signatures:

    • Identify habitat-specific protein variants through comparative analysis

    • Link protein function parameters to environmental variables

  • Integration with field data:

    • Combine genetic data with species distribution surveys

    • Correlate MT-CO2 variants with habitat characteristics in areas showing interspecific competition between C. medius and Microcebus species

These integrated approaches can help determine how cheirogaleid species adapt to different forest types in Madagascar, from dry deciduous forests to moist evergreen forests, informing conservation efforts in the face of habitat fragmentation .

What protocols yield optimal expression and purification of recombinant C. medius MT-CO2?

For optimal expression and purification of recombinant C. medius MT-CO2:

Expression optimization:

  • Test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express)

  • Optimize induction parameters (IPTG concentration: 0.1-1.0 mM; temperature: 15-37°C)

  • Implement auto-induction media for higher yields

  • Consider using specialized expression systems for membrane-associated proteins

Purification strategy:

  • Lyse cells using sonication or pressure-based methods in buffer containing mild detergents

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Include imidazole gradient (20-250 mM) to minimize non-specific binding

  • Consider secondary purification step (ion exchange or size exclusion chromatography)

  • Dialyze against final buffer containing stabilizers (trehalose, glycerol)

Quality control:

  • Verify purity by SDS-PAGE (target: >90%)

  • Confirm identity using western blot with anti-His and anti-MT-CO2 antibodies

  • Validate protein folding using circular dichroism spectroscopy

  • Conduct mass spectrometry to confirm full-length expression

This optimized protocol typically yields 3-5 mg of purified protein per liter of bacterial culture .

How should I design antibodies against specific epitopes of C. medius MT-CO2?

When designing antibodies against C. medius MT-CO2:

  • Epitope selection considerations:

    • Choose regions with high antigenicity and surface accessibility

    • Avoid transmembrane domains (typically hydrophobic regions)

    • Select species-specific regions for distinguishing between lemur species

    • Consider conserved regions for cross-species reactivity

  • Recommended epitope regions:

    • N-terminal region (amino acids 1-20): Species-specific epitopes

    • Central loop region (amino acids 110-130): Highly antigenic

    • C-terminal region (amino acids 200-227): Accessible in the folded protein

  • Antibody format selection:

    • Polyclonal antibodies: Better for detecting denatured protein in western blots

    • Monoclonal antibodies: Preferable for immunoprecipitation and specific epitope recognition

    • Recombinant antibodies: For reproducibility in long-term projects

  • Validation strategy:

    • Test antibody against recombinant protein with and without the tag

    • Verify specificity against MT-CO2 from related species

    • Validate in multiple applications (western blot, ELISA, immunoprecipitation)

Custom antibodies against C. medius MT-CO2 are valuable tools for studying protein-protein interactions in the respiratory chain complex and for monitoring expression levels in different physiological states.

How can recombinant C. medius MT-CO2 inform conservation strategies for lemurs?

Recombinant C. medius MT-CO2 serves as a valuable reference tool in conservation genomics by:

  • Facilitating genetic diversity assessment:

    • Providing reference sequences for designing primers targeting MT-CO2 in field samples

    • Enabling standardized comparisons across populations and studies

  • Supporting population structure analysis:

    • Identifying diagnostic mutations distinguishing subpopulations

    • Revealing historical gene flow patterns between lemur populations

  • Enhancing non-invasive sampling techniques:

    • Developing sensitive PCR and sequencing protocols using the recombinant protein as a positive control

    • Optimizing DNA extraction methods from fecal or hair samples

  • Monitoring population health:

    • Detecting functionally significant mutations that might affect metabolic efficiency

    • Assessing genetic adaptation to habitat fragmentation

Conservation research utilizing MT-CO2 has revealed that while C. medius appears relatively adaptable to different forest types and moderate habitat degradation, it shows clear dependence on forested habitats with tree holes for hibernation, emphasizing the importance of preserving these specific microhabitats .

What are the methodological challenges in applying MT-CO2 data to interspecific competition studies?

Using MT-CO2 data to study interspecific competition between cheirogaleid species presents several methodological challenges:

  • Genetic-ecological correlation difficulties:

    • Establishing direct links between genetic markers and competitive traits

    • Separating genetic signals of adaptation from neutral evolution

  • Sampling biases:

    • Ensuring representative sampling across competition gradients

    • Accounting for seasonal variation in detection probability, particularly during torpor periods

  • Data integration challenges:

    • Combining genetic data with ecological observations

    • Standardizing methodologies across different field sites

  • Analytical considerations:

    • Implementing multivariate analyses that account for spatial autocorrelation

    • Developing models that incorporate both genetic and ecological parameters

Research on spatial associations between C. medius and Microcebus species demonstrates the importance of integrated approaches, as these species show complex interactions influenced by habitat type and seasonality. For example, C. medius partially displaces M. murinus in some contexts while showing positive spatial associations with M. berthae, indicating relaxed competition .

What protocols are most effective for analyzing MT-CO2 from degraded field samples?

For effective analysis of MT-CO2 from degraded field samples:

Sample collection optimization:

  • Prioritize sample types with higher mitochondrial content (muscle, hair follicles)

  • Preserve samples in RNAlater or 95% ethanol for field collection

  • Implement silica gel drying for non-invasive samples

  • Store at cooler temperatures when possible

DNA extraction methods:

  • Use specialized kits designed for degraded samples

  • Implement silica-based extraction methods with modified binding conditions

  • Include carrier RNA to improve recovery of low-concentration DNA

  • Extend lysis times for difficult samples

Amplification strategy:

  • Design multiple primer pairs targeting short overlapping fragments (100-200 bp)

  • Implement touchdown PCR protocols to improve specificity

  • Use high-fidelity polymerases with proofreading capability

  • Consider digital droplet PCR for extremely low-concentration samples

Sequencing considerations:

  • Apply multiple sequencing approaches for verification

  • Implement strict quality filtering

  • Use the recombinant protein sequence as a reference for assembly validation

These protocols have been successfully applied in conservation genomic studies of cheirogaleid primates across Madagascar, overcoming challenges associated with field conditions and limited sample availability .

What are common issues with recombinant C. medius MT-CO2 experiments and their solutions?

ProblemPossible CausesSolutions
Low expression yieldProtein toxicity to E. coliUse tightly regulated promoters; lower induction temperature to 15-18°C
Codon biasUse Rosetta or CodonPlus strains; optimize codon usage
Protein instabilityAdd protease inhibitors; express as fusion protein
Poor solubilityMembrane protein characteristicsInclude mild detergents (0.1% DDM or CHAPS) in lysis buffer
Improper foldingExpress at lower temperatures; add folding enhancers
Inclusion body formationDevelop refolding protocols; use solubility tags
Loss of activityOxidation of critical residuesInclude reducing agents; handle under nitrogen
Improper disulfide formationAdd oxidized/reduced glutathione pairs during purification
Cofactor lossSupplement with heme during purification
Protein degradationProtease contaminationInclude additional protease inhibitors; reduce purification time
Storage conditionsStore in glycerol at -80°C; avoid freeze-thaw cycles
Non-specific bindingInsufficient washingIncrease imidazole in wash buffers (up to 50mM)
High hydrophobicityInclude mild detergents in all buffers

How can I troubleshoot contradictory results in comparative analyses using MT-CO2?

When facing contradictory results in comparative analyses:

  • Sequence verification checks:

    • Re-sequence the recombinant construct to confirm accuracy

    • Verify sample identities using multiple genetic markers

    • Check for potential contamination through phylogenetic placement

  • Methodological assessment:

    • Compare different phylogenetic algorithms (Maximum Likelihood, Bayesian, Parsimony)

    • Apply different substitution models and test model sensitivity

    • Implement bootstrap analyses to assess node support

  • Biological explanations:

    • Investigate potential introgression or hybridization events

    • Consider incomplete lineage sorting in recently diverged lineages

    • Test for selection pressures that might affect evolutionary rates

  • Data quality evaluation:

    • Assess sequence quality metrics and coverage

    • Check for nuclear mitochondrial DNA segments (NUMTs)

    • Evaluate potential sequence alignment errors

Contradictory results often reveal interesting biological phenomena rather than methodological errors. For example, ancient introgression events have been detected in lemur populations through careful analysis of discordant phylogenetic signals between mitochondrial and nuclear markers .

What emerging technologies might enhance research applications of recombinant C. medius MT-CO2?

Several emerging technologies hold promise for advancing research with recombinant C. medius MT-CO2:

  • CRISPR-based functional studies:

    • Precise genome editing to introduce C. medius MT-CO2 variants into model systems

    • Creating cellular models for functional testing of sequence variants

  • Single-cell approaches:

    • Analyzing MT-CO2 expression patterns at the single-cell level across tissues

    • Correlating expression with cellular metabolic states

  • Advanced structural biology:

    • Cryo-EM analysis of the complete respiratory complex containing MT-CO2

    • Molecular dynamics simulations to understand functional adaptations

  • Nanobody development:

    • Creating highly specific recombinant antibody fragments for in vivo studies

    • Developing intrabodies to track MT-CO2 in living cells

  • Environmental DNA applications:

    • Designing eDNA approaches for non-invasive population monitoring

    • Developing highly sensitive detection methods for low-quality samples

These technologies promise to expand our understanding of C. medius MT-CO2 beyond basic sequence analysis to functional adaptations relevant to conservation and evolutionary biology.

How might C. medius MT-CO2 research inform climate change adaptation studies?

C. medius MT-CO2 research has significant potential to inform climate change adaptation studies:

  • Metabolic adaptation research:

    • Investigating how torpor-related adaptations in MT-CO2 might respond to temperature changes

    • Comparing functional parameters across populations from different climatic zones

  • Experimental evolution approaches:

    • Expressing C. medius MT-CO2 under simulated future climate conditions

    • Assessing performance metrics under varying temperature and humidity profiles

  • Phenology impact assessment:

    • Correlating genetic variants with hibernation timing shifts

    • Modeling potential mismatches between hibernation patterns and resource availability

  • Comparative analyses across habitat gradients:

    • Studying functional differences in MT-CO2 between populations in dry deciduous forests versus moist evergreen forests

    • Identifying potential pre-adaptations to changing conditions

The unique hibernation capability of C. medius makes it a valuable model for studying metabolic adaptations to resource scarcity, which may become increasingly relevant as climate change alters habitat conditions across Madagascar .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.