Recombinant Chelon labrosus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Chelon labrosus Rhodopsin (rho)

Recombinant Chelon labrosus Rhodopsin (rho) is a full-length, His-tagged protein (1–353 amino acids) expressed in E. coli. This recombinant construct (UniProt ID: Q9YGZ8) serves as a model for studying rhodopsin structure, function, and photoreception mechanisms. Below is a detailed analysis of its characteristics, production, and potential applications.

Amino Acid Sequence

The full-length sequence includes critical domains for photoreception, including seven transmembrane helices and a chromophore-binding pocket (Q9YGZ8). Key motifs align with conserved rhodopsin features, such as the Schiff base-binding lysine (K296) and retinal-binding residues .

Primary Uses

  • SDS-PAGE Analysis: Validates protein integrity and purity .

  • Structural Studies: Full-length recombinant proteins enable cryo-EM or X-ray crystallography to resolve rhodopsin’s native conformation .

  • Functional Assays: Potential use in studying photoreceptor signaling, though activity data are not explicitly stated .

Comparative Analysis of Recombinant Rhodopsins

SpeciesKey FeaturesApplicationsSources
Chelon labrosusFull-length, His-tagged, E. coli-expressedStructural studies, SDS-PAGE
HumanMutant alleles (e.g., P23H, T17M)Gene therapy, pharmacological chaperones
MouseTransgenic models for retinitis pigmentosaCRISPR-based ablation/replacement
Sepia officinalisFull-length, His-taggedComparative photoreceptor studies

Research Implications and Future Directions

  1. Structural Insights: The recombinant protein could resolve Chelon labrosus rhodopsin’s disc membrane organization, analogous to human rhodopsin’s hierarchical packing .

  2. Evolutionary Perspectives: Comparative studies between fish and mammalian rhodopsins may elucidate photoreceptor adaptations to aquatic vs. terrestrial environments.

  3. Therapeutic Relevance: While not directly linked to human disease, insights into protein stability or folding could inform drug design for RHO-associated retinopathies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Chelon labrosus (Thicklip grey mullet) (Mugil chelo)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPVNFLTLY VTLEHKKLRTPLNYILLNLAVADLFMVLGGFTTTMYTSMHGYFVLGRLGCNVEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFSEDHAIMGLAFTWVMASACAVPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVSRMVVIMVVAFLVCWCPYAGVAWYIFTHQGSEFGPLFMTFPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Photoreceptor required for image-forming vision at low light intensity. While most salt water fish species use retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What are the optimal expression systems for recombinant Chelon labrosus Rhodopsin?

Heterologous expression systems like HEK293T cells have proven effective for rhodopsin expression studies. For recombinant Chelon labrosus Rhodopsin, mammalian cell lines are typically preferred due to their appropriate post-translational modification machinery. Expression vectors containing constitutive promoters (e.g., CMV) with epitope tags (such as 1D4) facilitate purification and detection. The p1D4-hrGFP II expression vector has been successfully used for rhodopsin expression in multiple species . When expressing rhodopsin, supplementation with 9-cis-retinal or 11-cis-retinal (5 μM) is often necessary to enhance protein stability and proper folding .

How can I assess the plasma membrane expression of recombinant Chelon labrosus Rhodopsin?

Plasma membrane expression (PME) can be quantitatively assessed using techniques such as deep mutational scanning with fluorescence-activated cell sorting (FACS). This approach allows for the comparative analysis of wild-type versus mutant rhodopsin trafficking to the plasma membrane. For Chelon labrosus Rhodopsin, establish a baseline PME for the wild-type protein before characterizing variants. Fluorescently-tagged constructs can be analyzed by confocal microscopy to determine subcellular localization, while cell surface biotinylation followed by Western blotting provides quantitative PME data .

What methods are recommended for measuring spectral properties of recombinant Chelon labrosus Rhodopsin?

Spectral properties of recombinant Chelon labrosus Rhodopsin can be measured using UV-visible spectroscopy. After purification in detergent micelles (typically using 0.1% n-dodecyl-β-D-maltoside), absorption spectra should be recorded in the dark and after photobleaching with appropriate wavelengths of light. The difference spectrum reveals the λ-max and can confirm proper chromophore binding. For more sensitive measurements, especially with low expression yields, fluorescence spectroscopy can be employed to monitor intrinsic tryptophan fluorescence before and after photobleaching, as demonstrated in zebrafish rhodopsin studies .

What is the recommended protocol for assessing retinal release kinetics of Chelon labrosus Rhodopsin?

Retinal release kinetics can be measured using fluorescence spectroscopy by monitoring the increase in intrinsic tryptophan fluorescence upon chromophore dissociation. A detailed protocol includes:

  • Purify recombinant Chelon labrosus Rhodopsin in sodium phosphate buffer (50 mM NaPhos, 0.1% DM, pH 7)

  • Incubate samples at controlled temperature (20°C) in submicro fluorometer cell cuvettes

  • Record baseline fluorescence (excitation 295 nm, emission 330 nm)

  • Photobleach samples for 30 seconds using a filtered light source (>475 nm)

  • Measure fluorescence at 30-second intervals for at least 30 minutes

  • Fit data to a first-order exponential equation (y = yo + a(1-e^-bx))

  • Calculate half-life values based on the rate constant 'b' (t1/2 = ln2/b)

This method has been successfully applied to measure retinal release in visual rhodopsins (t1/2 ≈ 6.5-7.6 min) and non-visual opsins (t1/2 ≈ 1.6 min) .

How can I design a mutagenesis study to investigate structure-function relationships in Chelon labrosus Rhodopsin?

Design a comprehensive mutagenesis study using the following approach:

  • Identify conserved residues through multiple sequence alignment of rhodopsins across species

  • Target residues in key functional domains:

    • Retinal binding pocket

    • G-protein interaction sites

    • Dimerization interfaces

    • Transmembrane domains

  • Generate a library of single-point mutants using site-directed mutagenesis

  • Express mutants in HEK293T cells with supplemental 9-cis-retinal

  • Assess each variant for:

    • Plasma membrane expression (PME)

    • Retinal binding capacity

    • G-protein activation

    • Thermal stability

Deep mutational scanning approaches can efficiently characterize multiple variants simultaneously, providing quantitative data on how each mutation affects rhodopsin function and stability .

What controls should be included when characterizing the spectral properties of recombinant Chelon labrosus Rhodopsin?

When characterizing spectral properties, include the following controls:

  • Non-transfected host cells processed identically to transfected samples

  • Cells expressing a known rhodopsin (e.g., bovine rhodopsin) as a positive control

  • Apoprotein samples without retinal supplementation

  • Dark state measurements before any light exposure

  • Multiple time points after photobleaching to track photointermediates

  • Temperature controls (typically at both 4°C and 20°C)

Additionally, when using fluorescence spectroscopy, include controls to verify that the excitation beam itself does not cause noticeable pigment bleaching. For measurements of retinal release, confirm complete bleaching by demonstrating that fluorescence reaches a plateau .

How can evolutionary analysis inform structure-function studies of Chelon labrosus Rhodopsin?

Evolutionary analysis provides critical context for structure-function studies of Chelon labrosus Rhodopsin through several approaches:

  • Construct a maximum-likelihood phylogenetic tree using rhodopsin sequences from diverse fish species

  • Calculate selective pressure metrics (ω = dN/dS) to identify:

    • Conserved functional domains (ω << 1)

    • Potentially adaptive sites (ω > 1)

    • Lineage-specific changes

  • Apply codon-based models (e.g., PAML's site models, branch models, and branch-site models) to test for:

    • Variation in selective constraint across sites (M3 vs M0)

    • Presence of positively selected sites (M2a vs M1a; M8 vs M7)

    • Shifts in selective pressure along specific branches

  • Focus functional studies on sites showing evidence of positive selection or altered selective constraint

Typical analyses reveal strong purifying selection in rhodopsins (average ω ≈ 0.07-0.09), reflecting functional constraints, with evidence of accelerated evolution at specific sites following gene duplication events .

What approaches can be used to assess the stability of Chelon labrosus Rhodopsin variants and their response to potential therapeutic compounds?

To assess stability and compound responsiveness of Chelon labrosus Rhodopsin variants:

  • Thermal stability assays:

    • Differential scanning fluorimetry

    • Circular dichroism spectroscopy at increasing temperatures

    • Fluorescence-based thermal denaturation curves

  • Chemical stability:

    • Resistance to detergent denaturation

    • pH stability profiles

    • Time-dependent activity loss at defined conditions

  • Corrector compound screening:

    • Test plasma membrane expression in presence of various concentrations of stabilizing compounds

    • Compare PME enhancement across different variants

    • Establish dose-response relationships

  • Structure-based computational approaches:

    • Calculate theoretical estimates of stabilization afforded by retinal binding

    • Use molecular dynamics simulations to identify variants that directly disrupt retinal binding

    • Predict structural impacts of mutations on protein stability

Studies have shown that response to retinal varies greatly across rhodopsin variants, with stability generally constraining responsiveness and binding calculations revealing that unresponsive variants often directly disrupt retinal binding sites .

How can I design experiments to investigate the differential effects of various retinal analogs on Chelon labrosus Rhodopsin stability?

Design experiments to investigate retinal analog effects using this systematic approach:

  • Select diverse retinal analogs:

    • 9-cis-retinal (photostable isomer)

    • 11-cis-retinal (native chromophore)

    • All-trans-retinal

    • Synthetic retinal analogs with modified ring structures or polyene chains

  • Expression system optimization:

    • Establish consistent expression of Chelon labrosus Rhodopsin in HEK293T cells

    • Optimize detergent solubilization conditions

  • Quantitative comparison methodology:

    • Deep mutational scanning to quantitatively compare plasma membrane expression

    • Standardize concentrations (typically 5 μM) across all retinal analogs

    • Measure plasma membrane expression using flow cytometry

  • Stability assessment:

    • Compare theoretical estimates of stabilization energy with experimental results

    • Measure regeneration of rhodopsin pigments using spectroscopy

    • Assess residual signaling activity in vitro

  • Data analysis:

    • Normalize responses relative to no-retinal controls

    • Calculate fold-change in expression for each analog

    • Identify structure-activity relationships

This approach can identify retinal analogs that provide the greatest stabilization for specific rhodopsin variants, potentially guiding therapeutic development for retinopathies .

What are common issues in recombinant Chelon labrosus Rhodopsin expression and how can they be resolved?

Common challenges and solutions include:

  • Low expression yields:

    • Optimize codon usage for the host expression system

    • Test different cell lines (HEK293T, COS-7, SF9)

    • Include molecular chaperones as co-expression partners

    • Supplement media with 9-cis-retinal (5 μM) during expression

  • Misfolding and aggregation:

    • Lower expression temperature (28-30°C instead of 37°C)

    • Add chemical chaperones to the culture medium (e.g., 4-phenylbutyrate)

    • Optimize detergent selection for solubilization (DM, DDM, LMNG)

  • Poor plasma membrane localization:

    • Verify signal peptide functionality

    • Create fusion constructs with well-trafficked membrane proteins

    • Screen for pharmacological chaperones that enhance trafficking

  • Difficulty in spectroscopic characterization:

    • Ensure complete protection from light during purification

    • Increase protein concentration through optimized purification

    • Use more sensitive fluorescence-based assays if absorbance signals are weak

How should I interpret changes in retinal release kinetics when comparing wild-type and mutant Chelon labrosus Rhodopsin?

Interpret retinal release kinetics data using these guidelines:

  • Half-life comparisons:

    • Faster retinal release (shorter t1/2) generally indicates decreased conformational stability

    • Similar t1/2 values (within 15-20%) suggest comparable stability of the retinal binding pocket

    • Significantly slower release may indicate altered Meta II decay kinetics

  • Activation energy analysis:

    • Measure retinal release at multiple temperatures

    • Calculate activation energy (Ea) using Arrhenius plots

    • Higher Ea values generally indicate more stable retinal-protein interactions

  • Correlation with function:

    • Visual rhodopsins typically exhibit slower retinal release (t1/2 ≈ 6-8 min)

    • Non-visual opsins often show faster release (t1/2 ≈ 1-2 min)

    • Mutations affecting G-protein interaction may alter retinal release rates

  • Statistical analysis:

    • Perform replicate measurements (n ≥ 3)

    • Report mean ± standard error

    • Use appropriate statistical tests to determine significance of differences

The retinal release half-life provides insights into both the stability of the opsin-retinal interaction and the conformational changes following photoactivation .

What considerations are important when analyzing selective pressure on the Chelon labrosus Rhodopsin gene compared to rhodopsins in other species?

When analyzing selective pressure on Chelon labrosus Rhodopsin:

  • Sampling considerations:

    • Ensure balanced taxonomic sampling across fish species

    • Include closely related species for fine-scale evolutionary analysis

    • Incorporate distantly related outgroups for proper evolutionary context

  • Model selection:

    • Test multiple evolutionary models (M0, M1a, M2a, M3, M7, M8a, M8)

    • Run analyses multiple times with different initial parameters (κ, ω)

    • Perform likelihood ratio tests to determine best-fitting models

  • Branch-specific analysis:

    • Test for lineage-specific selective pressures using branch models

    • Apply branch-site models to detect positive selection affecting only some sites in specific lineages

    • Use clade models to test for divergent selective constraints between clades

  • Interpretation guidelines:

    • Strong purifying selection (ω ≈ 0.07-0.09) is typical for functional rhodopsins

    • Evidence of positive selection (ω > 1) at specific sites may indicate adaptation to different visual environments

    • Changes in selective constraint following gene duplication events can indicate functional divergence

  • Statistical validation:

    • Confirm convergence of analyses by checking log likelihood plots

    • Use bootstrap analyses to assess confidence in selective pressure estimates

    • Apply Bonferroni corrections for multiple hypothesis testing

These approaches can reveal evolutionary patterns that inform functional studies and identify sites of potential adaptive significance .

How can deep mutational scanning be applied to comprehensively characterize Chelon labrosus Rhodopsin variants?

Deep mutational scanning (DMS) offers powerful approaches for comprehensive characterization:

  • Library construction strategy:

    • Generate complete single-site saturation mutagenesis library

    • Design primers to create all possible amino acid substitutions at each position

    • Construct the library using overlap extension PCR or array-based oligonucleotide synthesis

  • Expression and selection system:

    • Express the variant library in HEK293T cells

    • Supplement with 9-cis-retinal to assess corrector responsiveness

    • Use fluorescence-activated cell sorting (FACS) to isolate variants based on plasma membrane expression

  • Next-generation sequencing analysis:

    • Sequence the variant library before and after selection

    • Calculate enrichment scores to quantify the effect of each mutation

    • Apply appropriate normalization to account for sequencing biases

  • Data integration:

    • Map effects to structural models

    • Correlate with evolutionary conservation

    • Identify patterns of mutation effects in different protein domains

This approach has been successfully used to characterize the plasma membrane expression of 123 pathogenic rhodopsin variants, revealing significant variation in their response to stabilizing compounds like 9-cis-retinal .

What strategies can be employed to develop precision therapeutics for rhodopsin variants with different molecular defects?

Develop precision therapeutics using these strategic approaches:

  • Comprehensive variant characterization:

    • Classify variants based on molecular defects (trafficking, stability, signaling)

    • Identify "correctable" variants through deep mutational scanning

    • Quantify response to potential therapeutic compounds

  • Structure-based drug design:

    • Use crystal structures or homology models of Chelon labrosus Rhodopsin

    • Identify binding pockets for small molecule stabilizers

    • Apply virtual screening to identify compound candidates

  • High-throughput screening approaches:

    • Develop cell-based assays for rhodopsin function and trafficking

    • Screen compound libraries for molecules that enhance plasma membrane expression

    • Test compounds against a panel of representative variants

  • Combination therapy exploration:

    • Test synergistic effects between retinal analogs and other compounds

    • Combine treatments targeting different aspects of the molecular defect

    • Optimize dosing regimens based on variant-specific responses

  • Translation to animal models:

    • Generate knock-in models expressing specific rhodopsin variants

    • Validate therapeutic effects on retinal structure and function

    • Assess long-term efficacy and safety

These approaches can guide the development of precision therapeutics that target specific molecular defects in rhodopsin variants, potentially leading to treatments for currently untreatable retinopathies .

How can evolutionary analysis of rhodopsin genes inform the functional characterization of Chelon labrosus Rhodopsin?

Evolutionary analysis provides valuable insights through:

  • Identification of functionally important sites:

    • Sites under strong purifying selection (ω << 1) likely have critical functional roles

    • Residues conserved across diverse species should be prioritized for functional studies

    • Lineage-specific conserved sites may indicate adaptations to specific visual environments

  • Detection of adaptive evolution:

    • Sites under positive selection may contribute to species-specific visual adaptations

    • Changes in selective pressure following gene duplication events can reveal functional divergence

    • Correlation between positive selection and specific protein domains can identify functionally important regions

  • Comparative functional analysis:

    • Identify rhodopsin duplicates (like rh1-2) in related fish species

    • Compare functional properties (spectral tuning, retinal release kinetics)

    • Investigate differences in expression patterns and cellular localization

  • Reconstruction of ancestral sequences:

    • Generate and express ancestral rhodopsin sequences

    • Compare functional properties to extant rhodopsins

    • Trace the evolution of specific rhodopsin properties

These evolutionary approaches provide a framework for understanding functional differences between rhodopsins in different species and can guide the design of experiments to characterize Chelon labrosus Rhodopsin .

Comparative Analysis of Retinal Release Half-Lives in Fish Rhodopsins

SpeciesRhodopsin TypeRetinal Release Half-Life (min)Sample Size (n)Method
ZebrafishRh1 (visual)6.5 ± 0.36Fluorescence spectroscopy
ZebrafishRh1-27.6 ± 0.83Fluorescence spectroscopy
ZebrafishExo-rhodopsin (non-visual)1.6 ± 0.35Fluorescence spectroscopy
Chelon labrosusRh1 (predicted)6.0-7.5*-Based on phylogenetic relationship

*Predicted values based on evolutionary relationship; actual measurements for Chelon labrosus Rhodopsin would need to be experimentally determined .

Evolutionary Selective Pressure on Rhodopsin Genes

Gene GroupAverage ω (dN/dS)Evolutionary ModelInterpretation
All vertebrate rhodopsins0.07M0 (single ratio)Strong purifying selection
Ray-finned fish rhodopsins0.08M0 (single ratio)Strong purifying selection
Rh1-2 duplicate clade0.09M0 (single ratio)Slightly relaxed selective constraint
Sites with evidence of positive selection>1.0M8 (beta&ω)Potential adaptive significance

Note: No significant evidence of positive selection was found using likelihood ratio tests comparing models M2a vs M1a and M8 vs M8a (p >> 0.5 in all cases); significant among-site rate variation was detected (M3 vs M0, p < 0.00) .

Effect of 9-cis-Retinal on Plasma Membrane Expression of Rhodopsin Variants

Variant Response CategoryChange in PME with RetinalProportion of VariantsProbable Molecular Defect
High responders>2-fold increase~15%Primarily stability defects
Moderate responders1.5-2-fold increase~35%Combined stability and trafficking defects
Low responders1.0-1.5-fold increase~30%Trafficking defects with intact stability
Non-responders<1.0-fold change~20%Direct disruption of retinal binding

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.