Recombinant Chemotaxis protein LafT (lafT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling specific format requests. Please clearly indicate your desired format in the order notes section. We will do our best to accommodate your requirements.
Lead Time
Delivery timelines may vary depending on the purchasing method and location. We recommend contacting your local distributor for precise delivery estimates.
Note: All protein shipments are standardly packaged with regular blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it based on your specifications.
Synonyms
lafT; VPA1556; Chemotaxis protein LafT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Target Names
lafT
Target Protein Sequence
MQKFLGVLTILVCVFGGYMWAGGKLGAIWQPAEFLIIIGAAAGSLIIGNPPHVLKEMRQQ VPATIKGPTEEYEYYMELMALLNNLLETARSRGFKFLDSHIEAPEQSSIFLMYPLVSEDH RLISFITDNLRLMAMGQMSPHELEGLLEQEIEAIQNELLLPSRSLQRTAEALPGFGILAA VGGIIITMQAIDGSIALIGYHVAAALVGTFIGIFGCYCGLDPLSNAMAQRVKRNMTAFEC VRATLVAYVAKKPTLLAIDAGRKHIQLDIKPTFNQMEKWLAEQEG
Uniprot No.

Target Background

Function
LafT is essential for the rotation of the flagellar motor, likely functioning as a transmembrane proton channel.
Database Links

KEGG: vpa:VPA1556

STRING: 223926.VPA1556

Protein Families
MotA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of chemotaxis protein LafT in bacterial signaling?

Chemotaxis proteins like LafT play critical roles in signal transduction pathways that transmit information from transmembrane receptors to flagellar motors in bacterial chemotaxis. Similar to other chemotaxis proteins such as CheW and CheY, LafT would likely function within a complex signaling cascade that enables bacteria to sense and respond to environmental chemical gradients. These proteins are essential for proper chemotactic response, allowing cells to move toward attractants and away from repellents through coordinated regulation of flagellar rotation .

The functionality of chemotaxis proteins can be verified through complementation experiments, where the introduction of the recombinant protein restores the swarming ability of mutant strains lacking the native protein. True chemotaxis (as opposed to pseudotaxis) is characterized by swarms with sharp edges (chemotaxis rings), smooth-swimming bias in cells taken from the swarm edge, and observable chemotaxis in temporal gradient assays .

What expression systems are most suitable for recombinant LafT production?

Escherichia coli expression systems are commonly employed for the production of recombinant chemotaxis proteins. Specifically, BL21(DE3) cells have proven effective for expressing recombinant proteins with various tags, including 6×His tags that facilitate purification . For chemotaxis proteins like LafT, expression vectors with IPTG-inducible promoters such as tac promoters allow controlled protein production .

When optimizing expression conditions, multiple factors should be considered:

  • Induction temperature (lower temperatures like 22°C may improve protein folding)

  • IPTG concentration (typically ranging from 50-100 μM for optimal expression)

  • Expression time (usually 4-6 hours post-induction)

  • Selection of appropriate affinity tags (6×His tags being common for purification purposes)

The choice of expression vector should balance high protein yield with maintaining protein functionality, as some tags or expression conditions may interfere with the native activity of chemotaxis proteins.

How can I detect successful expression of recombinant LafT protein?

Several methods can be employed to detect and quantify recombinant LafT protein expression:

  • SDS-PAGE analysis can visualize the expressed protein based on its molecular weight

  • Western blotting using antibodies specific to incorporated tags (e.g., HisProbe-HRP for polyhistidine-tagged proteins) provides more specific detection

  • Chemiluminescence assays using substrates like SuperSignal West Pico chemiluminescent substrate enable sensitive detection of tagged proteins

For His-tagged LafT, nickel-activated derivatives of horseradish peroxidase (HRP), such as INDIA HisProbe-HRP, can directly detect the recombinant fusion proteins after blotting. The detection is typically visualized using chemiluminescent substrates, providing a sensitive method to confirm successful expression .

What strategies can optimize the purification of recombinant LafT?

Purification of recombinant LafT can be optimized through immobilized metal affinity chromatography (IMAC) when the protein contains a polyhistidine tag. The following protocol elements are critical for successful purification:

  • Lysis buffer optimization: Include appropriate protease inhibitors and optimize salt concentration to maintain protein stability while minimizing non-specific binding

  • Column selection: Ni-nitrilotriacetic acid (NTA) columns are particularly effective for purifying His-tagged proteins

  • Imidazole gradient: Implement a stepwise elution with increasing imidazole concentrations to separate the target protein from contaminants

  • Post-purification processing: Consider additional purification steps such as size exclusion chromatography to increase purity if needed

The efficiency of purification can be monitored through SDS-PAGE analysis of different fractions, with Western blotting confirming the presence of the target protein in specific fractions. This approach allows for the identification of optimal elution conditions and assessment of protein purity .

How can I assess the functional activity of purified recombinant LafT?

Functional activity of recombinant chemotaxis proteins can be assessed through multiple complementary approaches:

  • Complementation assays: Introducing recombinant LafT into mutant strains lacking the native protein should restore chemotactic ability if the recombinant protein is functional. This can be quantified through swarm plate assays measuring colony diameter expansion over time

  • Temporal gradient assays: Functional chemotaxis proteins should enable bacterial cells to respond to temporal changes in attractant or repellent concentrations, which can be observed microscopically as changes in swimming patterns (tumbling vs. smooth swimming)

  • Protein-protein interaction assays: Co-immunoprecipitation or pull-down assays can verify interactions with other components of the chemotaxis signaling pathway

Assay TypeMeasurement ParameterExpected Result for Functional Protein
Swarm plateColony diameterRestoration of swarming in mutants; chemotaxis rings with sharp edges
Temporal gradientSwimming patternSmooth-swimming bias in response to attractants; tumbling in response to repellents
Protein interactionBinding affinityDetectable interaction with known chemotaxis pathway components

Statistical analysis of these assays should show significant differences between complemented mutants and negative controls, confirming the functionality of the recombinant protein .

What chemical modifications can be incorporated into recombinant LafT for advanced studies?

Non-natural amino acids can be incorporated into recombinant proteins for various research applications. For instance, azide-containing amino acids like azidohomoalanine can be incorporated as methionine surrogates during protein expression in E. coli. This enables chemoselective modification of the protein through reactions like the Staudinger ligation .

The kinetic parameters for activation of azidohomoalanine by methionyl-tRNA synthetase (MetRS) have been characterized:

Analogk<sub>cat</sub>/K<sub>m</sub> (s<sup>−1</sup>⋅μM<sup>−1</sup>)k<sub>cat</sub>/K<sub>m</sub> (rel)Relative protein yield (%)
Met5.47 × 10<sup>−1</sup>1100
Azidohomoalanine1.42 × 10<sup>−3</sup>1/390100

These modifications allow for site-specific labeling with various functional groups including fluorophores, affinity tags, or bioorthogonal reactive groups. The selectivity of reactions like the Staudinger ligation is high enough to proceed even in complex cell lysate mixtures, making it possible to selectively modify the target protein among many cellular components .

What are the critical considerations for designing experiments to study LafT chemotaxis function?

When designing experiments to study chemotaxis protein function, researchers should consider:

  • Control selection: Include both positive controls (wild-type strains) and negative controls (mutant strains without complementation) in all functional assays

  • Environmental parameters: Standardize temperature, media composition, and incubation times, as these factors significantly impact chemotaxis behavior

  • Induction conditions: Carefully titrate expression levels, as both insufficient and excessive protein levels can yield misleading results

  • Validation methods: Employ multiple independent assays to confirm functionality (e.g., swarm plate assays, microscopic swimming pattern analysis, and biochemical interaction studies)

The research design should ensure that evidence obtained enables researchers to address questions about protein function unambiguously. This requires specifying the type of evidence needed to test hypotheses about LafT function and planning critical controls to rule out alternative explanations for observed phenotypes .

How can I troubleshoot poor expression yields of recombinant LafT?

Poor expression yields of recombinant chemotaxis proteins may result from various factors. Systematic troubleshooting approaches include:

  • Codon optimization: Analyze the coding sequence for rare codons that might limit translation efficiency in the host organism

  • Expression conditions adjustment:

    • Test multiple induction temperatures (15°C, 22°C, 30°C, 37°C)

    • Vary IPTG concentrations (10 μM to 1 mM range)

    • Adjust induction duration (2-24 hours)

  • Vector modification: Consider using different promoters or fusion partners that might enhance solubility

  • Strain selection: Test multiple E. coli strains optimized for different expression challenges (e.g., BL21(DE3), BL21(DE3)pLysS, Rosetta strains for rare codons)

For each adjustment, monitor protein expression through SDS-PAGE and Western blotting to identify conditions that maximize yield while maintaining protein integrity. Keep detailed records of all conditions tested to identify patterns that may reveal underlying causes of poor expression.

What approaches can validate the specificity of LafT interactions with other chemotaxis pathway components?

Validating the specificity of interactions between chemotaxis proteins requires multiple complementary approaches:

  • In vivo complementation assays: Test whether recombinant LafT can functionally interact with other chemotaxis components by restoring chemotaxis in appropriate mutant strains

  • Biochemical interaction assays: Employ co-immunoprecipitation, pull-down assays, or surface plasmon resonance to quantify binding affinities and specificities

  • Domain mapping experiments: Create truncated or mutated versions of LafT to identify specific regions required for interactions

  • Cross-species complementation: Test whether LafT from one bacterial species can interact with chemotaxis components from another species, revealing conserved interaction interfaces

The ability of chemotaxis proteins to function across species barriers, as demonstrated for some CheW proteins, indicates conserved structural features that mediate interactions with other pathway components. For instance, CheW from Azospirillum brasilense can interact with transducers and CheA protein from E. coli chemotaxis machinery, suggesting structural conservation in the interaction interfaces .

How should I analyze chemotaxis swarming data to accurately measure LafT functionality?

Analysis of chemotaxis swarming data requires rigorous quantitative approaches:

  • Measurement standardization: Measure swarm diameters at consistent time points (typically 24, 48, and 72 hours) using calibrated imaging systems

  • Statistical analysis: Apply appropriate statistical tests (e.g., ANOVA followed by post-hoc tests) to determine if differences between wild-type, mutant, and complemented strains are significant

  • Morphological assessment: Evaluate not just swarm size but also swarm morphology (sharp edges indicating chemotaxis rings vs. diffuse edges suggesting pseudotaxis)

  • Time course analysis: Plot growth curves of swarm diameter over time to distinguish growth rate effects from chemotaxis effects

When analyzing complementation data, it's important to note that restoration of swarming alone does not necessarily indicate restoration of chemotactic response. True chemotaxis should be confirmed by additional criteria: (i) swarms with sharp edges (chemotaxis rings), (ii) cells from the swarm edge displaying appropriate swimming bias, and (iii) cells demonstrating chemotaxis in temporal gradient assays .

What controls are essential when evaluating the effect of chemical modifications on LafT function?

When evaluating how chemical modifications affect chemotaxis protein function, essential controls include:

  • Unmodified protein control: Compare the modified protein's activity to that of the native protein to quantify any functional changes

  • Reaction control: Ensure the chemical modification reaction proceeded as expected by analyzing a sample of the modified protein by mass spectrometry

  • Negative reaction control: Subject the native protein to identical reaction conditions without the modifying reagent to control for potential effects of the reaction conditions themselves

  • Partial modification controls: When possible, create proteins with varying degrees of modification to establish dose-response relationships

For instance, when incorporating non-natural amino acids like azidohomoalanine, researchers should verify incorporation using mass spectrometry and compare the activity of the modified protein to that of the wild-type protein. Additionally, when performing selective chemical modifications like the Staudinger ligation, control reactions with wild-type protein (lacking the azide functionality) should show no modification, confirming reaction specificity .

How can I determine if heterologous expression has affected the native conformation and function of LafT?

Assessing whether heterologous expression has affected the native conformation and function of chemotaxis proteins involves multiple analytical approaches:

  • Structural analysis: Compare the secondary structure content of recombinant and native proteins using circular dichroism spectroscopy

  • Thermal stability assessment: Perform differential scanning calorimetry to compare the thermal denaturation profiles of recombinant and native proteins

  • Functional comparison: Quantitatively compare the activity of recombinant protein to that of the native protein in standardized assays

  • Ligand binding studies: Compare binding affinities for known interaction partners between recombinant and native proteins

It's important to note that some expression conditions, like low temperature induction (22°C), have been shown to improve the functional folding of chemotaxis proteins. Additionally, the restoration of function in complementation assays provides strong evidence that the recombinant protein has achieved its native conformation, as incorrect folding would likely prevent functional interactions with other pathway components .

How can site-directed mutagenesis of LafT inform our understanding of chemotaxis signal transduction mechanisms?

Site-directed mutagenesis of chemotaxis proteins can reveal critical functional residues and domains:

  • Conservation-guided mutagenesis: Target highly conserved residues identified through sequence alignment of LafT homologs across different bacterial species

  • Interface mapping: Systematically mutate surface residues to identify those critical for interactions with other chemotaxis components

  • Functional domain analysis: Create truncation mutants to delineate domains responsible for specific functions

  • Allosteric regulation studies: Identify residues involved in conformational changes by creating mutations that lock the protein in specific states

The effects of mutations should be assessed through multiple functional assays, including complementation studies, protein-protein interaction assays, and in vitro activity measurements. Correlating the effects of specific mutations with structural information can provide mechanistic insights into how chemotaxis signals are transduced at the molecular level .

What approaches can be used to study the dynamics of LafT interactions in living cells?

Studying the dynamics of chemotaxis protein interactions in living cells requires specialized approaches:

  • Fluorescent protein fusions: Create LafT fusions with fluorescent proteins like EGFP or mCherry to track localization and dynamics in real-time

  • FRET-based interaction studies: Employ Förster resonance energy transfer between appropriately tagged chemotaxis proteins to monitor interactions in vivo

  • Single-molecule tracking: Use photoactivatable fluorescent proteins to follow individual LafT molecules within cells

  • Protein transduction technology: Introduce externally produced fluorescent-tagged LafT into cells using cell-penetrating peptides like TAT-HA to observe immediate effects on chemotaxis signaling

When creating fluorescent fusions, it's important to verify that the tags don't interfere with protein function through complementation assays. The TAT-HA tag strategy allows externally produced recombinant proteins to be introduced into cells, enabling observation of immediate effects without the lag associated with gene expression systems .

How does evolutionary conservation inform the functional analysis of LafT across bacterial species?

Evolutionary conservation analysis provides valuable insights into chemotaxis protein function:

  • Phylogenetic profiling: Map the presence/absence of LafT homologs across bacterial species to understand its evolutionary trajectory

  • Selective pressure analysis: Calculate Ka/Ks ratios across the protein sequence to identify regions under purifying or diversifying selection

  • Co-evolution analysis: Identify residues that show correlated evolutionary patterns, suggesting functional interdependence

  • Cross-species complementation: Test whether LafT from different species can functionally substitute for each other

Different evolutionary constraints have been observed on chemotaxis proteins. For instance, studies of CheW and CheY have revealed varying degrees of conservation across bacterial and archaeal species. The ability of chemotaxis proteins from one species to interact with components from another species, as demonstrated in complementation studies, suggests conservation of core functional interfaces despite sequence divergence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.