Recombinant Chenopodium rubrum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to minimize repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Oxybasis rubra (Red goosefoot) (Chenopodium rubrum)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O. This process generates O₂ and a proton gradient, which is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Photosystem Q (B) protein in Chenopodium rubrum?

The Photosystem Q (B) protein, also known as PsbQ, is an essential component of the oxygen-evolving complex (OEC) of Photosystem II in Chenopodium rubrum. This protein plays a crucial role in stabilizing the manganese cluster and facilitating efficient water oxidation during photosynthesis. Structurally, PsbQ features a characteristic fold that enables it to interact with other PSII proteins including D1, D2, CP47, and other OEC subunits . Under normal physiological conditions, PsbQ contributes to maintaining optimal quantum yields of PSII. Research has demonstrated that PsbQ undergoes significant changes during environmental stress conditions, indicating its importance in stress response mechanisms .

Experimental approaches to study PsbQ structure typically include:

  • X-ray crystallography for high-resolution structural determination

  • Circular dichroism spectroscopy for secondary structure analysis

  • Molecular dynamics simulations for understanding protein dynamics

How do recombinant expression systems affect the functionality of Chenopodium rubrum PsbQ protein?

Recombinant expression of Chenopodium rubrum PsbQ protein requires careful selection of expression systems to maintain native functionality. Studies indicate that prokaryotic expression systems (particularly E. coli) may produce functional protein but often lack post-translational modifications present in the native protein. Alternative expression systems include:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, high yield, cost-effectiveLimited post-translational modifications10-20 mg/L culture
Yeast (P. pastoris)Eukaryotic modifications, secretion possibleLonger expression time5-15 mg/L culture
Insect cellsBetter folding, more native-like modificationsComplex methodology, expensive2-8 mg/L culture
Plant-based systemsMost native-like modificationsLow yield, time-consuming0.5-3 mg/L culture

Functionality assessment should include chlorophyll fluorescence measurements, as changes in fluorescence parameters (F₀, Fₘ, Fᵥ/Fₘ) can indicate the proper integration of the recombinant protein into the photosystem complex .

What are the standard protocols for isolation and purification of native versus recombinant PsbQ protein?

For native PsbQ isolation:

  • Harvest Chenopodium rubrum leaves at optimal photosynthetic activity

  • Homogenize tissue in buffer containing 50 mM Tris-HCl (pH 7.5), 400 mM sucrose, 10 mM NaCl, and 5 mM MgCl₂

  • Isolate thylakoid membranes through differential centrifugation

  • Solubilize membranes using mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

  • Perform ion exchange chromatography followed by size exclusion

  • Verify purity using SDS-PAGE and immunoblot analysis with PsbQ-specific antibodies

For recombinant PsbQ:

  • Transform expression vector containing the PsbQ gene into selected expression system

  • Induce protein expression under optimized conditions

  • Lyse cells and purify using affinity chromatography (if tagged)

  • Remove affinity tag if necessary

  • Perform additional purification using ion exchange and gel filtration

  • Verify functional integrity through fluorescence measurements and activity assays

The choice of method significantly affects protein yield and functionality, with proper buffer conditions being crucial for maintaining structural integrity.

How do environmental stress conditions affect PsbQ expression and function in Chenopodium species?

Environmental stresses significantly impact PsbQ expression and functionality. Studies on drought stress in Chenopodium quinoa, a related species, have revealed that:

  • Prolonged drought (two weeks at 15% field capacity) leads to:

    • Swelling of thylakoids and starch accumulation in chloroplasts

    • Decrease in both PSI and PSII quantum yields

    • Alterations in chlorophyll fluorescence parameters

    • Specific changes in PsbQ protein levels detected via immunoblot analysis

  • Recovery mechanisms after stress:

    • Elevated recovery capacities of PSII and PSI photochemical activities observed after re-watering

    • Re-establishment of normal fluorescence parameters within two weeks of recovery

High-temperature stress also influences photosystem proteins, as demonstrated in other species where:

  • Heat stress affects the non-photochemical chlorophyll fluorescence quenching (NPQ)

  • Photosystem protection mechanisms involve pigment-protein complex interactions

  • Coefficient of photochemical quenching shows initial increase followed by gradual decrease under sustained heat stress

Research methodology should include time-course analyses of protein expression levels, fluorescence parameters, and electron microscopy of thylakoid membrane ultrastructure to fully characterize stress responses.

What analytical techniques provide the most accurate assessment of recombinant PsbQ integration into functional PSII complexes?

Several complementary techniques provide comprehensive assessment of recombinant PsbQ integration:

These methods should be applied in combination to provide a complete picture of recombinant protein functionality and integration.

What are the current challenges in developing site-directed mutants of PsbQ to investigate structure-function relationships?

Developing functional site-directed mutants of PsbQ presents several challenges:

  • Identifying critical residues:

    • Bioinformatic analysis of conserved regions across species

    • Molecular dynamics simulations to identify functionally important residues

    • Analysis of existing structural data to target interface regions

  • Expression and stability issues:

    • Mutations often destabilize the protein structure, requiring optimization of expression conditions

    • Some mutations may prevent proper folding or assembly into PSII

    • Modified buffer systems may be required to maintain stability of mutant proteins

  • Functional assessment challenges:

    • Distinguishing direct effects of mutations from indirect structural perturbations

    • Quantifying subtle changes in photosynthetic parameters

    • Isolating mutant effects from compensatory mechanisms

  • Methodological approaches:

    • Use of complementation studies in PsbQ-deficient systems

    • Application of rapid chlorophyll fluorescence induction kinetics (OJIP) to assess functional impact

    • Correlation analysis between structural changes and photosystem function

  • Data interpretation complexities:

    • Multiple roles of PsbQ may confound straightforward interpretation

    • Changes in one parameter may affect multiple aspects of photosystem function

    • Environmental conditions may influence mutant phenotypes

What experimental design best captures the dynamics of PsbQ function under fluctuating environmental conditions?

A comprehensive experimental design should include:

  • Controlled environment system:

    • Programmable growth chambers with precise temperature control (±1.0°C)

    • Adjustable light intensity using LED systems with defined spectral qualities

    • Controlled humidity and water availability parameters

  • Stress application protocol:

    • Gradual stress application (e.g., decreasing field capacity from 95% to 15% over defined periods)

    • Multi-level stress intensities (e.g., one-week vs. two-week drought periods)

    • Recovery phase monitoring (e.g., two-week recovery period)

  • Time-course measurements:

    • Regular sampling intervals (daily or bi-daily)

    • Consistent sampling time relative to photoperiod

    • Multiple biological and technical replicates

  • Comprehensive data collection:

    • Chlorophyll fluorescence parameters (F₀, Fₘ, Fᵥ/Fₘ, NPQ, qP)

    • Gas exchange measurements (net photosynthetic rate, stomatal conductance)

    • Biochemical analyses (protein levels, pigment contents)

    • Ultrastructural analyses (electron microscopy of thylakoids)

  • Data integration:

    • Correlation analyses between multiple parameters

    • Time-series modeling of photosystem dynamics

    • Principal component analysis to identify key factors driving responses

This design allows researchers to capture both immediate responses and adaptation mechanisms, providing insights into the dynamic role of PsbQ in photosystem regulation.

How should researchers optimize protein extraction protocols to maintain PsbQ stability and activity?

Optimized extraction protocols for PsbQ should address:

  • Buffer composition:

    • pH range: 7.0-7.5 (Tris-HCl or HEPES buffer systems)

    • Ionic strength: 100-300 mM (typically NaCl or KCl)

    • Stabilizing agents: 10-20% glycerol, 1-5 mM DTT or β-mercaptoethanol

    • Protease inhibitors: Complete cocktail with PMSF (1 mM)

  • Extraction conditions:

    • Temperature: All steps performed at 4°C

    • Mechanical disruption: Optimize between gentle (Potter-Elvehjem homogenizer) and more aggressive (bead-beating) methods

    • Centrifugation: Sequential steps (1,000×g → 10,000×g → 100,000×g) to separate cellular fractions

  • Membrane protein solubilization:

    • Detergent selection: n-dodecyl-β-D-maltoside (0.5-1%) or digitonin (0.5-2%)

    • Detergent:protein ratio optimization

    • Incubation time: 30-60 min at 4°C with gentle agitation

  • Storage conditions:

    • Short-term: 4°C in extraction buffer with reduced detergent concentration

    • Long-term: -80°C with 10-20% glycerol as cryoprotectant

    • Avoid repeated freeze-thaw cycles

  • Activity preservation:

    • Addition of stabilizing ions (Ca²⁺, Cl⁻) at physiological concentrations

    • Maintenance of associated lipids during purification

    • Protection from light exposure during handling

Experimental design should include stability tests under various conditions to determine optimal parameters for specific experimental objectives.

What are the most reliable approaches for measuring the impact of PsbQ modifications on electron transport dynamics?

For comprehensive assessment of electron transport dynamics affected by PsbQ modifications:

  • Fast chlorophyll fluorescence measurements:

    • OJIP transient analysis to evaluate specific steps of electron transport

    • Analysis of the OJ phase (represents reduction of QA)

    • Analysis of the JI phase (represents reduction of QB and PQ pool)

    • Analysis of the IP phase (represents reduction of electron acceptors of PSI)

  • P700 absorption measurements:

    • Determination of PSI oxidation-reduction kinetics

    • Assessment of cyclic vs. linear electron flow

    • Measurement of P700+ re-reduction rate as indicator of electron donation from PSII

  • Oxygen evolution measurements:

    • Clark-type electrode measurements under different light intensities

    • Flash-induced oxygen evolution patterns

    • Analysis of S-state transitions in the water-splitting complex

  • Spectroscopic analyses:

    • Thermoluminescence to assess charge recombination events

    • Electron paramagnetic resonance (EPR) to detect radical intermediates

    • Time-resolved fluorescence spectroscopy to measure energy transfer rates

  • Data interpretation framework:

    • Comparative analysis with wild-type protein

    • Mathematical modeling of electron transport kinetics

    • Correlation analysis between structural modifications and functional parameters

The combination of these approaches provides a comprehensive picture of how PsbQ modifications affect electron transport at multiple levels, from primary photochemistry to downstream electron acceptance and utilization.

How can researchers distinguish between direct effects of PsbQ alterations and secondary compensatory responses?

Distinguishing primary from secondary effects requires:

  • Time-course analyses:

    • Early responses (minutes to hours) often represent direct effects

    • Later responses (days) often include compensatory mechanisms

    • Detailed temporal resolution to capture transition points

  • Dose-response relationships:

    • Graduated modifications of PsbQ (partial knockdowns, varying mutation severity)

    • Correlation between modification level and physiological response

    • Threshold identification for triggering compensatory pathways

  • Multi-omics integration:

    • Transcriptomic analysis to identify rapidly altered gene expression

    • Proteomic analysis to detect changes in protein abundance and modifications

    • Metabolomic analysis to assess downstream metabolic adjustments

  • Genetic approaches:

    • Complementation studies with wild-type and modified PsbQ

    • Double mutant analysis with potential compensatory pathway components

    • Inducible expression systems to control timing of modification

  • Statistical analysis methods:

    • Principal component analysis to separate major response patterns

    • Hierarchical clustering to identify co-regulated parameters

    • Pathway enrichment analysis to identify compensatory mechanisms

By combining these approaches, researchers can develop a temporal and mechanistic model distinguishing direct PsbQ functions from plant adaptive responses.

What statistical approaches are most appropriate for analyzing chlorophyll fluorescence data in PsbQ modification studies?

Appropriate statistical approaches include:

  • Data preprocessing:

    • Normalization methods to account for leaf-to-leaf variation

    • Identification and handling of outliers

    • Transformation methods for non-normally distributed parameters

  • Descriptive statistics:

    • Mean and standard deviation/standard error for each treatment group

    • Box plots to visualize distribution characteristics

    • Coefficient of variation to assess measurement reliability

  • Inferential statistics:

    • ANOVA with appropriate post-hoc tests for multiple treatment comparisons

    • Mixed-effects models to account for repeated measures and nested designs

    • Non-parametric alternatives when assumptions of parametric tests are violated

  • Correlation and regression analyses:

    • Pearson/Spearman correlation to identify relationships between fluorescence parameters and other variables

    • Multiple regression to model relationships between environmental factors and fluorescence responses

    • Path analysis to disentangle direct and indirect effects

  • Advanced multivariate approaches:

    • Principal component analysis to reduce dimensionality of complex datasets

    • Discriminant analysis to identify parameters that best distinguish between treatment groups

    • Cluster analysis to identify patterns in fluorescence responses

  • Visualization techniques:

    • Heat maps for visualizing multiple parameters across treatments

    • Radar plots for comparing multiple fluorescence parameters simultaneously

    • Time-series plots with confidence intervals for longitudinal studies

These statistical approaches should be selected based on specific experimental designs and research questions to maximize the extraction of meaningful information from fluorescence data.

What are promising approaches for enhancing stress tolerance through PsbQ protein engineering?

Based on current understanding of PsbQ function, several promising approaches include:

These approaches should be systematically evaluated using both in vitro and in vivo experimental systems, with particular attention to potential trade-offs between stress tolerance and optimal performance under normal conditions.

How might advances in cryo-electron microscopy contribute to understanding PsbQ structure-function relationships?

Cryo-electron microscopy (cryo-EM) offers significant advantages for PsbQ research:

  • Technical advantages for photosystem proteins:

    • Preservation of native protein conformations in hydrated environments

    • Visualization of dynamic protein regions often missing in crystal structures

    • Ability to capture different functional states of the photosystem complex

    • No requirement for protein crystallization, which can be challenging for membrane proteins

  • Specific applications for PsbQ research:

    • Determination of precise binding interface between PsbQ and other PSII components

    • Visualization of conformational changes under different environmental conditions

    • Mapping of water and ion channels that may be critical for function

    • Observation of assembly/disassembly processes during stress responses

  • Integration with other structural methods:

    • Combination with molecular dynamics simulations for dynamic understanding

    • Integration with mass spectrometry for identifying interaction networks

    • Correlation with spectroscopic data for structure-function relationships

  • Methodological considerations:

    • Sample preparation optimization for membrane protein complexes

    • Data processing approaches for heterogeneous samples

    • Classification methods to identify distinct conformational states

  • Future developments:

    • Time-resolved cryo-EM to capture transient states during photosynthetic reactions

    • In situ cryo-electron tomography to visualize PSII organization in native thylakoid membranes

    • Correlative light and electron microscopy to link structural and functional data

These advances promise to provide unprecedented insights into how PsbQ contributes to PSII function and stress responses at the molecular level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.