Recombinant Cherry rasp leaf virus RNA1 polyprotein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The RNA1 polyprotein of CRLV is a single large polypeptide encoded by the viral RNA1 segment. It undergoes proteolytic cleavage by a virus-encoded 3C-like protease to yield functional proteins essential for replication. CRLV belongs to the genus Cheravirus and infects plants such as cherry, peach, and apple, causing diseases like "flat apple" . Recombinant versions of this polyprotein are produced in heterologous systems (e.g., E. coli) for structural and functional studies .

Production and Purification

Recombinant CRLV RNA1 polyprotein is synthesized using the following workflow:

Expression System: E. coli
Tag: N-terminal His-tag
Purity: >90% (verified by SDS-PAGE)
Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C

Research Applications

The recombinant protein is utilized in:

  1. Protease activity studies: Investigating cleavage site specificity (e.g., relaxed recognition of P1 residues like Arg, Cys, or Gly) .

  2. Host-pathogen interactions: Identifying plant proteins cleaved by CRLV proteases .

  3. Diagnostic development: Serving as an antigen for ELISA or RT-PCR primer design .

  4. Comparative virology: Analyzing sequence divergence between CRLV isolates (e.g., 15-aa deletion in the protease cofactor of flat apple isolates) .

Table 2: Notable Studies

Study FocusOutcomeSource
CRLV isolate comparisonRNA1 of flat apple (CRLV-FA) and potato (CRLV-pot) isolates share 95% aa identity
Cleavage site diversityNepovirus proteases (including CRLV) exhibit relaxed specificity at P1 residues (e.g., Cys, Arg)
Diagnostic sensitivityRT-PCR targeting RNA1 matches RNA2 in reliability for CRLV detection

Challenges and Future Directions

  • Structural resolution: The full-length RNA1 polyprotein’s 3D structure remains uncharacterized.

  • Functional annotation: Roles of domains like X1 and X2 in membrane association or host adaptation require further study .

  • Biotechnological applications: Engineering attenuated viral strains via cleavage site mutagenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
RNA1 polyprotein; Genome polyprotein B; P1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1544-2250
Protein Length
Full Length of Mature Protein
Species
Cherry rasp leaf virus (isolate Potato/United States) (CRLV)
Target Protein Sequence
GPEEMYIPTKNSECFGSVTKLGAWTGPKPYFLEKTSLIPSLISTSIDVERTTEPAILSQR DKRLKDSINPEFDVFLEGMKKYAVEAHSLDEDLEVFEDALDRVFLEIPEHACEDLTNDQV CNGIEDDPYAEGIVMQTAEGFPFCTQRPAGASGKSWLFAGAPGDWHIVPGSLLANEMHKK EVAPSRGLFEPLIGIDFPKDEKVDSSKVYIKPKTRLFTILPVDYNILVRKYFLSSVSHIM TQHNTIPVKVGIDCLSNEWSILYHQLRSKGTNWFNGDYSRFDGITPRNVLQGIVKRINKF YNNKNSLAITDSNLSINSDLARSLLTDMASTRYGLTNGDLWYVTSGIPSGFPLTVIVNSL VNNFFIHFSYIKLMKREELNSLYPLHSFRQMVAYATYGDDNLVSVNDVITEKFNLVKIAD LLAEHGVTLKNGADKNEEILSPFYPLEKVDFLKRKFVHYQGHVVAPLNPVNITERLHWIR KGLGEADATLENCSSAAFEALFHGRCYYDTLVAKIYKACAASKLSIQLPTYNDALAIFLS NDSFAKAIQTISLDLPKAIFVNKSNYFVSEIFPDVFFCSNERNVTLHKLLEITTTRNICY ISRNYESRNSSRGLFSLKGEGWALAPVSARLVVYKNMQKPVYFVDEANDGLALAYCLDYM LRIKGVSRSRLAQVLYNIFGHDETLCSRIASNFSLLDSNKYMPPHKK
Uniprot No.

Target Background

Function

Picornain 3C-like protease is a thiol protease likely involved in cleaving the B and M polyproteins. The viral genome-linked protein (VPg) plays a role in RNA replication.

Database Links

KEGG: vg:3021844

Protein Families
Comoviridae genome polyprotein B family
Subcellular Location
[Putative helicase]: Host membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of Cherry rasp leaf virus RNA1?

CRLV RNA1 consists of approximately 6992-7100 nucleotides (nt) excluding the 3' poly(A) tail. It contains a single open reading frame (ORF) that encodes a large polyprotein of approximately 2235 amino acid residues with a predicted molecular mass of 249.6 kDa . RNA1 has non-coding regions at both the 5' (142 nt) and 3' (145-230 nt) termini . The RNA1 polyprotein is post-translationally cleaved into several functional proteins including a protease cofactor (PCo), a nucleotide-binding helicase (Hel), a genome-linked protein (VPg), a proteinase (Pro), and the viral RNA-dependent RNA polymerase (Pol) .

How is Cherry rasp leaf virus taxonomically classified?

CRLV belongs to the genus Cheravirus within the family Secoviridae. Other members of the genus Cheravirus include apple latent spherical virus (ALSV), and currant latent virus (CuLV) . Phylogenetic analysis places CRLV in close relationship with other members of the genus based on comparisons of RNA1-encoded polyproteins . The taxonomic classification is determined through both sequence analysis and biological properties including particle morphology (isometric particles about 30 nm in diameter), genome organization, and host range .

What are the recommended methods for CRLV detection and RNA1 amplification?

Several methods can be employed for CRLV detection:

  • RT-PCR: Reverse transcription PCR targeting RNA1 has proven to be as sensitive and reliable as RT-PCR targeting RNA2 . This approach is particularly useful for detecting CRLV in woody hosts like apple where virus titers may be low.

  • ELISA: Enzyme-linked immunosorbent assay using antibodies specific to CRLV can be used for virus detection .

  • High-throughput sequencing (HTS): For novel isolate characterization or complete genome determination, HTS of either double-stranded RNA (dsRNA) extracts or total RNA is recommended . This approach has been successfully used to identify and characterize complete CRLV genomes.

For RNA1 amplification, overlapping cDNA fragments can be generated using virus-specific primers designed based on known sequences. The 5' and 3' termini can be determined using RACE (Rapid Amplification of cDNA Ends) techniques .

What is the relationship between CRLV and flat apple disease?

Molecular evidence has established that flat apple disease is associated with Cherry rasp leaf virus. Studies have demonstrated that:

  • Inocula from flat apple-infected trees can induce symptoms of rasp leaf in sweet cherry and vice versa .

  • CRLV and Flat apple disease-associated virus (FAV) are serologically related and have similar herbaceous host range and symptomatology .

  • The flat apple isolate of CRLV (CRLV-FA) RNA1 shares 94% nucleotide and 95% amino acid identity with the potato isolate (CRLV-pot) .

  • RT-PCR using primers designed based on CRLV sequences can successfully detect the virus in flat apple-diseased trees .

These findings confirm that flat apple disease is caused by a variant of CRLV, highlighting the importance of understanding RNA1 polyprotein for disease diagnosis and management.

What structural and functional domains have been identified in the CRLV RNA1 polyprotein?

The CRLV RNA1 polyprotein contains several conserved domains and motifs typical of related viruses in the Secoviridae family. Key structural and functional elements include:

  • Protease cofactor (PCo): Located at the N-terminus of the polyprotein, this region shows variability between isolates. In CRLV-FA, two deletions of 5 and 10 amino acids (total 15 aa) were observed in the variable N-terminus of the PCo compared to CRLV-pot .

  • Helicase domain: Contains a nucleoside triphosphate-binding protein domain (NTB) with conserved motifs typical of viral RNA helicases (EC 3.6.4.-) .

  • VPg (Viral genome-linked protein): Functions in viral RNA replication by serving as a primer for viral RNA synthesis.

  • Protease domain: Contains the "CG" motif characteristic of 3C-like proteinases responsible for polyprotein processing .

  • RNA-dependent RNA polymerase: Contains the characteristic "GDD" motif at the C-terminus, essential for viral replication .

Functional characterization through site-directed mutagenesis of these domains can provide insights into their roles in viral replication and pathogenesis.

How do different CRLV isolates vary in their RNA1 sequences and what are the implications for evolution?

Comparative analysis of CRLV isolates reveals significant sequence variability:

Isolate ComparisonRNA1 Nucleotide IdentityRNA1 Amino Acid IdentityReference
CRLV-FA vs. CRLV-pot94%95%
CLRV-Ch vs. CLRV-RhHigh similarity in Pro-Pol region-
Different CRLV host isolatesUp to 28% variability in 3'-UTRs-

The RNA1 of different CRLV isolates shows variable regions, particularly at the N-terminus of the polyprotein and in the 3'-UTR. The 3'-UTRs of CRLV isolates from the same host species share more than 98% sequence identity, but up to 17% variability is observed among isolates from different host species . This suggests host-specific adaptation.

The biological significance of these variations may include:

  • Host adaptation and range expansion

  • Altered virulence or pathogenicity

  • Potential for recombination with related viruses

  • Evolutionary diversification within the Cheravirus genus

For research purposes, these variations necessitate careful consideration when designing universal detection primers or developing resistance strategies.

What experimental approaches can be used to study CRLV RNA1 polyprotein processing and protein interactions?

Several methodological approaches can be employed to study CRLV RNA1 polyprotein processing and protein interactions:

  • In vitro translation systems: Cell-free translation systems using rabbit reticulocyte lysate or wheat germ extract can be used to express the full-length RNA1 polyprotein and study its processing.

  • Recombinant protein expression: Individual domains of the polyprotein can be expressed in bacterial (E. coli), yeast, or insect cell systems for purification and functional characterization .

  • Protease activity assays: To study the viral protease activity and cleavage site specificity, synthetic peptides corresponding to putative cleavage sites can be used as substrates.

  • Yeast two-hybrid or co-immunoprecipitation: These methods can identify interactions between viral proteins and between viral and host proteins.

  • Cryo-electron microscopy: For structural studies of the viral replication complex or individual protein domains.

  • Reverse genetics: Development of infectious cDNA clones allows for mutagenesis studies to determine the functional roles of specific domains or motifs within the RNA1 polyprotein .

When designing experiments, researchers should consider the storage conditions for recombinant proteins: store at -20°C for general storage, and at -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided .

How does the 5' terminal region of CRLV RNA1 compare to RNA2, and what is its functional significance?

A unique characteristic of CRLV and related viruses is the presence of nearly identical sequences at the 5' termini of both RNA segments:

  • The first 657 nucleotides of RNA1 and RNA2 of CRLV-Ch are 99% identical .

  • This region includes the 5'-UTR and the first 214 deduced amino acids of the polyproteins following the first of two in-frame start codons .

  • This repetition of coding sequence at the 5'-termini is also observed in ToRSV (Tomato ringspot virus) and CLRV-Rh but does not occur in all members of subgroup C nepoviruses .

The functional significance of this shared 5' region may include:

  • Translation regulation: Both RNA segments contain two potential in-frame AUG start codons, with the context of these codons conforming to Kozak consensus sequences for optimal translation initiation .

  • Internal ribosomal entry site (IRES): RNA secondary structure analysis suggests that the 5' regions may form structures similar to those in blackcurrant reversion virus (BRV) that provide an IRES for cap-independent translation .

  • Potential movement protein: Sequence comparison suggests that the region might encode a movement protein involved in cell-to-cell transport of the virus .

Further experimental approaches to study this region could include:

  • Development of full-length infectious clones for mutagenesis studies

  • In vitro translation assays to determine the actual translation start site

  • RNA structural analysis using SHAPE (Selective 2'-hydroxyl acylation analyzed by primer extension) or similar techniques

What strategies can be employed for expressing recombinant CRLV RNA1 polyprotein for structural and functional studies?

For researchers aiming to express recombinant CRLV RNA1 polyprotein or its domains, several expression strategies can be considered:

  • Expression Systems:

    • Bacterial expression: E. coli-based systems are suitable for expressing individual domains like the protease or polymerase, but may be challenging for the full-length polyprotein.

    • Yeast expression: Systems like Pichia pastoris can handle larger proteins with proper folding.

    • Insect cell expression: Baculovirus expression systems are ideal for large viral proteins requiring eukaryotic post-translational modifications.

    • Plant-based expression: Transient expression in Nicotiana benthamiana using viral vectors can produce functional viral proteins in their natural host environment.

  • Purification Approaches:

    • Affinity tags (His, GST, MBP) can facilitate purification but may affect protein function.

    • The tag type should be determined during the production process based on the specific domain being expressed .

    • For the RNA1 polyprotein, a Tris-based buffer with 50% glycerol has been effectively used .

  • Protein Storage:

    • Store purified protein at -20°C, or -80°C for extended storage.

    • Avoid repeated freezing and thawing.

    • Working aliquots can be stored at 4°C for up to one week .

  • Functional Verification:

    • RNA-dependent RNA polymerase activity can be assessed using in vitro RdRp assays.

    • Protease activity can be verified using fluorogenic peptide substrates corresponding to the natural cleavage sites.

    • Helicase activity can be evaluated using RNA unwinding assays.

Expression of specific regions, such as the Pro-Pol region (delineated by the "CG" motif of the 3C-like proteinase and the "GDD" motif of the polymerase), may be particularly useful for phylogenetic studies and functional characterization .

How can comparative genomics approaches be used to understand the evolution and host adaptation of CRLV RNA1?

Comparative genomics provides powerful tools for understanding CRLV evolution:

  • Whole Genome Phylogenetics:

    • Phylogenetic analysis of complete RNA1 sequences places CRLV within subgroup C of the genus Nepovirus .

    • CRLV is more closely related to CLRV-Rh and ToRSV than to other members of the genus Nepovirus .

    • Reconstructing evolutionary relationships can identify potential ancestral viruses and evolutionary trajectories.

  • Recombination Analysis:

    • Software like RDP4.1 can detect recombination events between virus isolates, as demonstrated in studies of related viruses like Rehmannia torradovirus virus (ReTV) .

    • Analysis should examine both intra-species recombination (between CRLV isolates) and inter-species recombination (with related viruses).

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across the RNA1 polyprotein to identify regions under positive or negative selection.

    • Different functional domains may experience different selection pressures, reflecting their roles in virus-host interactions.

  • Host Range Determinants:

    • Compare RNA1 sequences from CRLV isolates infecting different hosts (cherry, apple, potato) to identify potential host-specificity determinants.

    • The 3'-UTRs of CRLV isolates show up to 17% variability among isolates from different host species, suggesting a possible role in host adaptation .

  • Bayesian Phylodynamics:

    • Similar to approaches used for Cherry leaf roll virus , Bayesian phylodynamic frameworks can investigate the spatial diffusion patterns of CRLV by analyzing gene sequences from different geographical regions.

    • This approach can help identify viral origins and migration pathways, informing control strategies.

These comparative approaches can provide insights into CRLV evolution, host adaptation mechanisms, and potential strategies for developing resistance in crop plants.

What are the key considerations for sample collection and processing when studying CRLV RNA1?

Successful detection and characterization of CRLV RNA1 depends on appropriate sample collection and processing:

  • Tissue Selection:

    • For woody hosts (cherry, apple): Collect young leaves, phloem tissue, or fruit symptoms when present.

    • For herbaceous hosts: Collect symptomatic leaves showing chlorosis, mottling, or deformation.

    • Sampling during spring or early summer typically yields higher virus titers.

  • Sample Preservation:

    • Fresh tissue is optimal for RNA extraction.

    • If immediate processing is not possible, flash-freeze samples in liquid nitrogen and store at -80°C.

    • RNA stabilization reagents (e.g., RNAlater) can be used for field sampling.

    • For long-term storage, tissue can be dried over calcium chloride and preserved at room temperature .

  • Nucleic Acid Extraction Methods:

    • Total RNA extraction: Suitable for PCR-based detection and sequencing.

    • Double-stranded RNA extraction: Enriches for viral replicative forms, useful for HTS approaches .

    • Total nucleic acids extraction: Can be used for RT-PCR detection .

  • Viral Enrichment:

    • Mechanical transmission to indicator plants like Chenopodium quinoa can be used to propagate and isolate the virus .

    • Virion purification can be performed prior to RNA extraction for improved specificity.

These methodological considerations are essential for obtaining high-quality samples for downstream analysis of CRLV RNA1.

What are the challenges in developing an infectious clone system for CRLV RNA1 and how can they be addressed?

Developing infectious clones for CRLV RNA1 presents several challenges:

  • Size Constraints:

    • The large size of CRLV RNA1 (approximately 7 kb) can make it difficult to clone and manipulate in standard vectors.

    • Solution: Use low-copy plasmids designed for large inserts or consider in vitro ligation of smaller fragments.

  • RNA Secondary Structure:

    • Viral RNA often contains stable secondary structures that can impede reverse transcription and PCR amplification.

    • Solution: Use reverse transcriptases optimized for structured templates and PCR additives like DMSO or betaine to disrupt secondary structures.

  • Cytotoxicity:

    • Viral proteins expressed in bacteria may be toxic.

    • Solution: Use tightly regulated expression systems or consider direct RNA transcription approaches.

  • 5' and 3' End Determination:

    • Accurate cloning of the viral ends is critical for infectivity.

    • Solution: Use 5' and 3' RACE techniques to precisely determine terminal sequences before constructing the infectious clone .

  • In Vitro Transcription:

    • Generating functional transcripts requires appropriate 5' and 3' modifications.

    • Solution: Include a bacteriophage promoter (T7 or SP6) for in vitro transcription and ensure the 3' end can generate the poly(A) tail.

  • Delivery Methods:

    • Introducing the infectious transcripts into plant cells efficiently.

    • Solution: Optimize mechanical inoculation with capped transcripts or use Agrobacterium-mediated delivery.

The development of full-length infectious clones of CRLV would provide valuable tools for investigating the possible roles of the 5' terminal regions and other genome features through mutagenesis studies .

What are the promising research avenues for understanding CRLV RNA1 polyprotein function and virus-host interactions?

Several promising research directions could advance our understanding of CRLV RNA1 polyprotein:

  • CRISPR-Based Approaches:

    • Using CRISPR-Cas systems to target conserved regions of CRLV RNA1 could provide novel resistance strategies.

    • Editing susceptibility factors in host plants might confer resistance to CRLV infection.

  • Proteomics Studies:

    • Identifying host proteins that interact with CRLV RNA1-encoded proteins could reveal key host factors required for viral replication.

    • Characterizing the composition of viral replication complexes would enhance our understanding of the virus life cycle.

  • Structural Biology:

    • Determining the three-dimensional structures of key CRLV proteins (protease, polymerase) could facilitate the design of specific inhibitors.

    • Cryo-electron microscopy of replication complexes would provide insights into their assembly and function.

  • RNA Biology:

    • Investigating the role of the unusually long 3'-UTR in viral replication and host interactions.

    • Studying potential RNA-RNA interactions between genomic RNAs that might regulate translation or replication.

  • Host Range Determinants:

    • Identifying viral factors responsible for host range expansion, particularly those enabling infection of economically important crops.

    • Understanding how CRLV adapts to different host environments could lead to improved disease management strategies.

  • Virus-Vector Interactions:

    • Although a biological vector for CRLV remains undetermined, investigating potential vector relationships (similar to nematode transmission of ToRSV) could provide insights into virus epidemiology .

These research directions would not only advance our fundamental understanding of CRLV biology but could also lead to practical applications in disease management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.