Recombinant Chicken PTPLAD1 (UniProt ID: Q5ZM57) is a full-length, 362-amino acid protein fused with an N-terminal His tag for purification . Key specifications include:
The amino acid sequence begins with MADCSLRPHVHWAQRHRELYLRVELSDVKNPDVSIADNVLRFRAQGHGAKGDNIYEFQIE... .
PTPLAD1 (also termed HACD3) catalyzes the third step of the fatty acid elongation cycle: dehydration of 3-hydroxyacyl-CoA to trans-2-enoyl-CoA . Key findings include:
Substrate Specificity: Exhibits weak activity in saturated and monounsaturated fatty acid elongation compared to HACD1/HACD2 .
Redundancy: Hacd1 knockout mice retain ~60% dehydratase activity in skeletal muscle, indicating functional overlap with HACD2 .
Cellular Localization: Endoplasmic reticulum-bound, interacting with elongases (ELOVLs) and reductases (TER) .
PTPLAD1 suppresses colorectal cancer (CRC) metastasis by:
Inhibiting Raf/ERK Signaling: Binds prohibitin (PHB) to dephosphorylate PHB-Y259, disrupting PHB-Raf interaction and blocking ERK-driven epithelial-mesenchymal transition (EMT) .
Mitochondrial Dynamics: Reduces mitochondrial fission (mitofission) by modulating ERK activity .
Clinical Relevance: Low PTPLAD1 expression correlates with poor CRC prognosis .
While HACD1 mutations are linked to congenital myopathies, HACD3’s role remains indirect. Studies suggest compensatory mechanisms among HACD isoforms maintain lipid homeostasis in muscle .
| Enzyme | Activity in SFA/MUFA Elongation | PUFA Elongation | Tissue Expression |
|---|---|---|---|
| HACD1 | High | Low | Skeletal muscle |
| HACD2 | High | Moderate | Ubiquitous |
| HACD3 | Low | Not detected | Ubiquitous (lower levels) |
| HACD4 | None | None | Testis, placenta |
SFA: Saturated fatty acids; MUFA: Monounsaturated; PUFA: Polyunsaturated .
Recombinant Chicken 3-hydroxyacyl-CoA dehydratase (PTPLAD1) catalyzes the third step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the addition of two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. Specifically, it dehydrates the 3-hydroxyacyl-CoA intermediate to trans-2,3-enoyl-CoA during each elongation cycle. This enzyme participates in VLCFA biosynthesis, contributing to the production of various chain lengths involved in diverse biological processes as precursors for membrane lipids and lipid mediators. Furthermore, PTPLAD1 is implicated in Rac1 signaling pathways, modulating gene expression.
PTPLAD1 (Protein-tyrosine phosphatase-like A domain-containing protein 1) is also known by several synonyms including HACD3, RCJMB04_3b6, 3R-3-hydroxyacyl-CoA dehydratase, and 3-hydroxyacyl-CoA dehydratase. This protein is involved in very-long-chain fatty acid (VLCFA) synthesis as part of the elongation cycle in lipid metabolism . The gene encoding this protein is referenced in databases under the name HACD3, with UniProt ID Q5ZM57 for the chicken variant .
For optimal storage and reconstitution of recombinant PTPLAD1:
Store the lyophilized protein at -20°C to -80°C upon receipt
Aliquot to prevent repeated freeze-thaw cycles, which can compromise protein integrity
For reconstitution:
Briefly centrifuge the vial before opening
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (50% is standard) for long-term storage
Short-term working aliquots can be stored at 4°C for up to one week
The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .
PTPLAD1 has been shown to modulate the Raf/ERK signaling pathway through a specific molecular mechanism. Research indicates that:
PTPLAD1 binds with prohibitin (PHB) via its middle fragment (amino acids 141-178)
This binding induces dephosphorylation of PHB at tyrosine-259 (PHB-Y259)
The dephosphorylation disrupts the interaction between PHB and Raf
This disruption results in inactivation of Raf/ERK signaling
This mechanism explains how PTPLAD1 can suppress metastasis in colorectal cancer by inhibiting both EMT and mitochondrial fission processes that are critical for cancer progression .
PTPLAD1 expression has been negatively associated with poor survival in colorectal cancer patients. Studies show that PTPLAD1 is down-regulated in highly metastatic colorectal cancer cells, and systematic analysis reveals that both EMT and MFT are critical features in colorectal cancer patients with low PTPLAD1 expression. Additionally, PTPLAD1 has been implicated in other diseases including HCV infection and type 2 diabetes .
| PTPLAD1 Expression Level | Associated Cancer Phenotype | Patient Outcome |
|---|---|---|
| High (score ≥9) | Less metastatic potential | Better survival |
| Low (score <9) | High metastatic potential | Poor survival |
Recombinant chicken PTPLAD1 can be expressed and purified using the following general protocol:
Expression System: Use E. coli as the host organism for protein expression
Vector Design:
Clone the full-length chicken PTPLAD1 sequence (1-362 aa) into an appropriate expression vector
Include an N-terminal His-tag for affinity purification
Expression Conditions:
Induce protein expression at optimal temperature and IPTG concentration
Harvest cells and lyse using appropriate buffer systems
Purification:
Use Ni-NTA or other His-tag affinity chromatography
Consider additional purification steps such as ion exchange or gel filtration
Quality Control:
Several methodological approaches can be employed to study PTPLAD1 interactions with binding partners such as PHB:
Co-immunoprecipitation (Co-IP):
Use anti-PTPLAD1 antibodies to pull down protein complexes
Identify binding partners through Western blotting or mass spectrometry
Protein Fragment Analysis:
Phosphorylation Analysis:
Fluorescence Resonance Energy Transfer (FRET):
Tag PTPLAD1 and suspected binding partners with appropriate fluorophores
Analyze protein-protein proximity in living cells
When designing experiments to investigate PTPLAD1's role in cancer:
Expression Modulation:
Create stable cell lines with PTPLAD1 overexpression or knockdown
Use inducible systems for temporal control of expression
In Vitro Assays:
Cell migration and invasion assays to assess metastatic potential
Western blot analysis of EMT markers (E-cadherin, vimentin, Snail)
Mitochondrial morphology assessment using fluorescence microscopy
Signaling Pathway Analysis:
Monitor Raf/ERK pathway activation using phospho-specific antibodies
Use pathway inhibitors (e.g., U0126 for MEK/ERK) as controls
In Vivo Models:
Inject cancer cells with modified PTPLAD1 expression into immunodeficient mice
For example, use a model with 1×10^6 luciferase-expressing cells injected intravenously
Monitor metastasis formation through bioluminescence imaging
Consider combining with pathway inhibitors or doxycycline-inducible systems
While specific post-translational modifications of chicken PTPLAD1 are not extensively characterized in the provided search results, this represents an important research direction. Based on its role in signaling and protein-protein interactions, researchers should consider investigating:
Phosphorylation sites:
Identify potential phosphorylation sites using bioinformatics tools
Determine if phosphorylation affects binding to partners like PHB
Use phospho-mimetic mutations (e.g., Ser/Thr to Asp) to study functional effects
Other modifications:
Investigate potential ubiquitination sites that might regulate protein stability
Study acetylation or methylation that could affect protein-protein interactions
Methodological approaches:
Mass spectrometry to identify modification sites
Site-directed mutagenesis to create modification-resistant variants
Immunoprecipitation with modification-specific antibodies
When faced with contradictory findings regarding PTPLAD1 function:
Context-dependent analysis:
Compare experimental conditions, cell types, and tissues used in different studies
Determine if PTPLAD1 has tissue-specific binding partners or functions
Isoform analysis:
Verify which PTPLAD1 isoforms were studied in different reports
Determine if results differ based on specific protein domains present/absent
Methodological approaches:
Conduct parallel experiments in multiple cell lines to confirm cell-type specificity
Use both gain-of-function and loss-of-function approaches in the same system
Employ multiple techniques to verify protein-protein interactions (e.g., Co-IP, proximity ligation assay)
Integrate with broader pathways:
Consider PTPLAD1's dual roles in metabolism and signaling
Investigate if metabolic conditions affect its signaling functions and vice versa
PTPLAD1/HACD3 and HADH (short-chain L-3-hydroxyacyl-CoA dehydrogenase) are both involved in fatty acid metabolism but have distinct properties and research applications:
| Feature | PTPLAD1/HACD3 | HADH |
|---|---|---|
| Primary function | 3-hydroxyacyl-CoA dehydratase activity in fatty acid elongation | Catalyzes third step of fatty acid oxidation in mitochondria |
| Cellular localization | Endoplasmic reticulum | Mitochondria |
| Role in cancer | Anti-metastatic factor in colorectal cancer | Differentially expressed in various cancers |
| Mechanism in cancer | Disrupts PHB-Raf interaction to inhibit EMT and mitofission | Involved in metabolic reprogramming |
| Research applications | Studying metastasis suppression mechanisms | Studying metabolic alterations in cancer |
When choosing between these proteins for research:
Select PTPLAD1 for studies on fatty acid elongation and EMT signaling
Choose HADH for investigations of mitochondrial fatty acid oxidation
Consider both proteins when examining metabolic reprogramming in cancer
When designing domain-specific functional studies:
Emerging research on PTPLAD1 reveals its multifunctional nature beyond its canonical role in fatty acid metabolism. Key trends include:
Dual functionality: Recognition of PTPLAD1 as both a metabolic enzyme and a signaling molecule
Cancer biology: Increasing evidence for its role as an anti-metastatic factor
Therapeutic potential: Possible development of strategies to modulate PTPLAD1 activity in cancer treatment
Structural biology: Efforts to better understand the protein's functional domains
Future research is likely to focus on developing small molecules that can enhance PTPLAD1 activity or mimic its effects on the PHB-Raf interaction, potentially leading to novel cancer therapeutics .
Several methodological advances could enhance PTPLAD1 research:
CRISPR-Cas9 genome editing:
Creation of precise domain mutations in endogenous PTPLAD1
Generation of conditional knockout models to study tissue-specific functions
Cryo-EM or X-ray crystallography:
Determination of the complete protein structure, especially in complex with binding partners
Identification of critical binding pockets for drug design
Single-cell analysis:
Investigation of cell-to-cell variation in PTPLAD1 expression and function
Correlation with cellular phenotypes in heterogeneous tumor samples
Organoid models:
Study of PTPLAD1 function in more physiologically relevant 3D culture systems
Testing of potential therapeutics in patient-derived organoids
These methodological advances would provide deeper insights into PTPLAD1 biology and accelerate its potential applications in disease treatment .