Recombinant Chicken Abhydrolase domain-containing protein 13 (ABHD13)

Shipped with Ice Packs
In Stock

Description

General Information

ABHD13, or Abhydrolase Domain-Containing 13, is a protein-coding gene that, in humans, is associated with diseases such as Williams-Beuren Syndrome and polyneuropathy . It is part of the serine hydrolase family of enzymes, which are characterized by a conserved nucleophilic serine residue in their active site that facilitates various hydrolytic reactions . ABHD13 is predicted to enable palmitoyl-(protein) hydrolase activity and is involved in protein depalmitoylation and is located in dendrite cytoplasm . Orthologous to the human ABHD13, the mouse Abhd13 is expressed in metanephros .

Synonyms:

  • 1110065L07Rik

Expression and Interactions

Research has shown that the expression of ABHD13 can be influenced by various compounds .

Table 1: Compounds Affecting ABHD13 Expression in Rats

CompoundEffect on Expression
2,3,7,8-TetrachlorodibenzodioxineDecreased
2-MethoxyethanolIncreased
3,3',4,4'-TetrachlorobiphenylMultiple interactions
3-Chloropropane-1,2-diolIncreased
3H-1,2-Dithiole-3-thioneDecreased
Aflatoxin B1Decreased methylation/Increased methylation
Aflatoxin M1Decreased
AmitroleDecreased
Antirheumatic drugDecreased
Bisphenol AMultiple interactions
DoxorubicinDecreased
FlutamideIncreased
Folic acidDecreased
IrinotecanDecreased
Methylmercury chlorideDecreased
ParacetamolIncreased
Perfluorooctane-1-sulfonic acidDecreased/Multiple interactions
Pirinixic acidDecreased
SB 431542Multiple interactions
TestosteroneMultiple interactions

Functional Studies

ABHD13 is predicted to have palmitoyl-(protein) hydrolase activity and is involved in protein depalmitoylation .

Role in Disease

ABHD13 is associated with Williams-Beuren Syndrome and polyneuropathy . Certain compounds that influence ABHD13 expression have links to diseases. For example, aflatoxins, which decrease ABHD13 methylation and expression, are associated with an increased risk of hepatocellular carcinoma .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ABHD13; RCJMB04_17d11; Protein ABHD13; Alpha/beta hydrolase domain-containing protein 13; Abhydrolase domain-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ABHD13
Target Protein Sequence
MEKSRMLWTFVERWLLALASWSWGLCRISLLPLIVTFHLYGGIILLLLIFVSIAGILYKF QDMLLYFPEQPSSSRLYVPMPTGIPHENIFIKTKDGVLLNLILLRYTGDNAAYSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSEGEASEEGLYIDSEAVLDYVMTRS DLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPL WCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPARTKRLAIFPDGTHND TWQCQGYFTALEQFIKEVIKSHSSEEMAKTSSNVTII
Uniprot No.

Target Background

Database Links
Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is chicken ABHD13 and what is its functional characterization?

Chicken ABHD13 (Abhydrolase Domain Containing 13) is a member of the α/β hydrolase fold domain protein family, characterized by a conserved catalytic triad that predicts esterase activity. Unlike some other ABHD family proteins, chicken ABHD13 lacks the HX4D motif, suggesting it does not possess acyltransferase activity . The protein is predicted to be a single-pass type II membrane protein, though this has not been experimentally confirmed in chicken models.

Based on studies of mammalian homologs, ABHD13 likely plays a role in phospholipid metabolism, particularly in the breakdown of specific phospholipid species . In mammalian models, ABHD13 is ubiquitously expressed, with notable expression in the brain (particularly hippocampus), testes, and distal small intestine . Chicken ABHD13 is available as a recombinant protein produced in various expression systems including E. coli, mammalian cells, and wheat germ cell-free systems .

For researchers beginning work with chicken ABHD13, initial characterization should include:

  • Western blot confirmation of protein expression

  • Subcellular localization studies using fluorescent tags or immunocytochemistry

  • Basic enzymatic activity assays targeting predicted phospholipid substrates

  • Expression profiling across chicken tissues using qPCR or proteomics approaches

What expression systems are available for producing recombinant chicken ABHD13?

Several expression systems have been validated for the production of recombinant chicken ABHD13, each with distinct advantages depending on your research objectives:

  • E. coli expression system: Provides high yield and is cost-effective, but may lack post-translational modifications found in eukaryotic systems. For chicken ABHD13, optimization of codon usage for E. coli is recommended, along with testing multiple fusion tags (His, GST, etc.) to improve solubility .

  • Mammalian cell expression: HEK293 cells are commonly used for chicken ABHD13 expression when proper folding and post-translational modifications are critical. This system better recapitulates the protein's native environment but has lower yields and higher costs than bacterial systems .

  • Wheat germ cell-free system: A eukaryotic expression system that allows for rapid protein production without cell culture. This system is particularly useful for initial characterization studies of chicken ABHD13 .

  • Avian expression systems: For studying chicken ABHD13 in a more native context, transgenic chicken models or chicken cell lines can be employed, though these are more technically challenging .

When selecting an expression system, consider the downstream application requirements. For structural studies, large quantities of pure protein from E. coli may be suitable, while functional studies might benefit from protein expressed in mammalian systems with appropriate post-translational modifications.

What are the fundamental purification strategies for recombinant chicken ABHD13?

Purification of recombinant chicken ABHD13 typically follows a multi-step process that must be optimized based on the expression system used and the fusion tags employed. A general methodological approach includes:

  • Cell lysis optimization: For membrane-associated proteins like ABHD13, test different detergents (Triton X-100, CHAPS, or DDM) at varying concentrations to maximize protein extraction while maintaining enzymatic activity.

  • Affinity chromatography: If expressed with an affinity tag (His, GST, Fc, or Avi as available from commercial sources ), use the corresponding resin for initial capture:

    • His-tagged ABHD13: Ni-NTA or IMAC resins with imidazole gradient elution

    • GST-tagged ABHD13: Glutathione sepharose with reduced glutathione elution

    • Fc-tagged ABHD13: Protein A/G columns with low pH or competitive elution

  • Secondary purification: Ion exchange chromatography (typically anion exchange as ABHD13 has a predicted pI in the acidic range) is recommended for removing contaminants with similar affinity profiles.

  • Size exclusion chromatography: Final polishing step to separate monomeric ABHD13 from aggregates and remaining impurities.

  • Quality control assessment: SDS-PAGE with Coomassie staining, Western blotting, and enzyme activity assays to confirm the identity, purity, and functionality of the purified protein.

For chicken ABHD13 specifically, buffer optimization is critical, with typical buffers containing 20-50 mM Tris or phosphate buffer (pH 7.5-8.0), 150-300 mM NaCl, and potentially low concentrations of non-ionic detergents if the membrane association is maintained.

How can I design effective enzymatic assays for chicken ABHD13?

Designing enzymatic assays for chicken ABHD13 requires consideration of its predicted hydrolase activity and potential substrates. Based on studies of mammalian ABHD proteins, the following methodological approaches are recommended:

  • Fluorescence-based assays:

    • Substrate options: Use fluorogenic ester substrates like 4-methylumbelliferyl esters or resorufin esters with varying acyl chain lengths

    • Assay conditions: Buffer at pH 7.5-8.0, 37°C, with and without detergents

    • Controls: Include heat-inactivated enzyme and known esterase inhibitors

    • Data analysis: Calculate Km and Vmax values to characterize substrate preference

  • Phospholipid hydrolysis assays:

    • Substrate preparation: Radiolabeled or fluorescently labeled phospholipids, particularly phosphatidylcholine variants

    • Assay format: Thin-layer chromatography (TLC) or HPLC separation of reaction products

    • Product detection: Autoradiography, fluorescence scanning, or mass spectrometry

    • Quantification: Compare hydrolysis rates across different phospholipid species

  • Mass spectrometry-based approaches:

    • Untargeted lipidomics to identify changes in lipid profiles when ABHD13 is overexpressed or knocked down

    • Targeted analysis of specific phospholipid classes based on predicted activity

    • MALDI-TOF MS for rapid screening of substrate specificity

When designing these assays, it's important to note that ABHD13's natural substrates remain poorly characterized even in mammalian systems . As such, a broad initial screen using diverse lipid substrates is recommended, followed by more focused analyses on promising candidates.

What are the challenges in determining the subcellular localization of chicken ABHD13?

Determining the subcellular localization of chicken ABHD13 presents several challenges that require specific methodological approaches:

  • Membrane association complexity:

    • ABHD13 is predicted to be a single-pass type II membrane protein , but this has not been experimentally confirmed in chicken

    • Approach: Use fractionation techniques to separate membrane compartments, combined with Western blot analysis

    • Challenge: Incomplete membrane separation can lead to ambiguous results

  • Antibody specificity issues:

    • Commercial antibodies may cross-react with other ABHD family members

    • Solution: Validate antibodies using ABHD13 knockout/knockdown controls or heterologous expression systems

    • Alternative: Use epitope-tagged recombinant chicken ABHD13 constructs for localization studies

  • Dynamic localization possibilities:

    • ABHD13 localization may change with cellular conditions or circadian rhythms as suggested by mammalian studies

    • Approach: Time-course imaging experiments and stimulation studies

    • Methods: Live-cell imaging with fluorescently tagged ABHD13 at different time points or following cellular stimulation

  • Tissue-specific variations:

    • Localization patterns may differ across tissue types

    • Strategy: Compare localization in multiple cell types derived from tissues with high ABHD13 expression

    • Techniques: Immunohistochemistry of chicken tissue sections combined with organelle markers

A robust experimental design would include:

  • Generation of GFP/RFP-tagged chicken ABHD13 constructs

  • Co-localization studies with established organelle markers (ER, Golgi, plasma membrane)

  • Subcellular fractionation with subsequent Western blot analysis

  • Super-resolution microscopy for detailed localization if initial studies indicate complex patterns

How do post-translational modifications affect chicken ABHD13 function?

Post-translational modifications (PTMs) of chicken ABHD13 likely play crucial roles in regulating its localization, activity, and protein-protein interactions. Based on studies of other ABHD family members and mammalian ABHD13, several key PTMs and their functional implications should be considered:

  • Phosphorylation sites:

    • Prediction tools suggest multiple potential phosphorylation sites in chicken ABHD13

    • Methodology: Phosphoproteomic analysis using LC-MS/MS after enrichment with TiO2 or phospho-antibodies

    • Functional assessment: Site-directed mutagenesis of predicted phosphorylation sites (Ser/Thr to Ala) followed by activity assays

    • Related findings: Other ABHD proteins like ABHD15 are known to be regulated by phosphorylation in insulin signaling pathways

  • Glycosylation:

    • N-linked glycosylation may occur at conserved motifs (Asn-X-Ser/Thr)

    • Detection methods: PNGase F treatment followed by mobility shift analysis; lectin blotting

    • Impact assessment: Compare enzymatic activity of glycosylated versus deglycosylated protein

    • Relevance: Glycosylation patterns in recombinant proteins can differ based on expression system

  • Ubiquitination and protein stability:

    • Prediction of ubiquitination sites using bioinformatic tools

    • Experimental approach: Cycloheximide chase assays with ubiquitination site mutants

    • Analysis method: Proteasome inhibitors (MG132) to assess degradation pathways

  • Lipid modifications:

    • As a membrane protein, chicken ABHD13 may undergo lipidation

    • Detection: Click chemistry approaches with lipid analogs

    • Functional impact: Mutation of predicted lipidation sites followed by membrane fractionation studies

A comprehensive PTM analysis workflow should include:

  • In silico prediction of modification sites

  • Mass spectrometry-based PTM mapping

  • Generation of site-specific mutants

  • Functional assays comparing wild-type and mutant proteins

  • Stimulus-dependent changes in modification patterns

What methodologies are most effective for identifying physiological substrates of chicken ABHD13?

Identifying the physiological substrates of chicken ABHD13 requires a multi-faceted approach combining untargeted discovery methods with targeted validation. Based on the limited knowledge of ABHD13 function , the following comprehensive strategy is recommended:

  • Comparative lipidomics workflow:

    • Experimental design: Compare lipid profiles in tissues/cells with ABHD13 overexpression, knockout, or catalytic mutant expression

    • Tissue selection: Focus on brain (hippocampus), small intestine, and testes based on high expression patterns in mammalian homologs

    • Methodology:

      • Untargeted LC-MS/MS lipidomics

      • Stable isotope labeling to track lipid metabolism kinetics

      • Data analysis using multivariate statistics to identify significantly altered lipid species

  • Activity-based protein profiling (ABPP):

    • Approach: Use activity-based probes that target serine hydrolases

    • Implementation: Compare probe labeling patterns in the presence of wild-type ABHD13 versus catalytic mutants

    • Advantage: Can identify both substrates and interacting proteins simultaneously

  • Substrate trapping approach:

    • Strategy: Generate catalytically inactive mutants that bind but cannot process substrates

    • Methods: Immunoprecipitation followed by lipid extraction and analysis

    • Controls: Compare substrate binding between wild-type and mutant proteins

  • Validation experiments:

    • In vitro enzyme assays with candidate substrates

    • Structure-activity relationship studies with modified substrates

    • Kinetic analysis to determine substrate preference

Research has shown that other ABHD family members have substrate selectivity for specific phospholipids . For example, ABHD3 selectively cleaves medium-chain phosphatidylcholines . A similar targeted approach focusing on phospholipid libraries with varying acyl chain lengths would be a logical starting point for chicken ABHD13 substrate identification.

How can chicken ABHD13 be used to model human neurological disorders?

Chicken ABHD13 can serve as a valuable model for studying human neurological disorders, particularly given the association of ABHD13 mutations with conditions like Alzheimer's and Parkinson's disease . A comprehensive research program would include:

  • Comparative genomics foundation:

    • Analysis of sequence conservation between chicken and human ABHD13

    • Identification of conserved domains and critical residues

    • Mapping of human disease-associated mutations onto the chicken ABHD13 sequence

  • In vitro disease modeling approaches:

    • Generation of chicken cell lines expressing ABHD13 variants corresponding to human disease mutations

    • Primary neuronal cultures from chicken embryos with ABHD13 modifications

    • Assessment of:

      • Phospholipid metabolism alterations

      • Cellular stress responses

      • Protein aggregation phenotypes

      • Mitochondrial function

  • In vivo chicken models:

    • Development of transgenic chicken models using viral vectors or CRISPR-Cas9 technology

    • Advantages of chicken models:

      • More rapid development than mammalian models

      • Well-characterized neuroanatomy

      • Established behavioral assays

    • Parameters to assess:

      • Histopathological changes in brain tissue

      • Behavioral and cognitive changes

      • Lipidomic profiles in affected tissues

  • Translational research pipeline:

    • Screening of compound libraries for modulators of ABHD13 activity

    • Validation in chicken models before moving to mammalian models

    • Assessment of drug effects on both wild-type and mutant ABHD13 functions

This approach leverages the efficiency of chicken models while maintaining relevance to human disease. The use of genetically modified chickens has been validated for protein production and disease modeling , making this a feasible approach for ABHD13 research with translational potential.

What are the experimental considerations for studying chicken ABHD13 circadian regulation?

Studies in mammals have suggested that ABHD13 expression may be regulated by circadian rhythms, particularly in liver tissue . Investigating this phenomenon in chicken ABHD13 requires careful experimental design with the following considerations:

  • Temporal sampling protocol:

    • Experimental design: Collect tissue samples every 4 hours across a 24-hour cycle for at least 48 hours

    • Environmental controls:

      • Maintain consistent light/dark cycles (12h:12h is standard)

      • Control for feeding times and composition

      • Monitor and record body temperature

    • Sample processing: Immediate flash freezing to preserve temporal expression patterns

  • Multi-level expression analysis:

    • Transcriptional regulation:

      • qRT-PCR analysis of ABHD13 mRNA levels

      • Promoter analysis for circadian elements (E-box, D-box, ROR elements)

      • ChIP assays to assess binding of circadian transcription factors (CLOCK, BMAL1)

    • Protein expression:

      • Western blot quantification with time-specific normalization

      • Immunohistochemistry at key timepoints

    • Activity patterns:

      • Enzymatic assays at different circadian timepoints

      • Correlation of activity with expression levels

  • Tissue-specific considerations:

    • Primary targets based on mammalian data:

      • Liver (strong circadian regulation in mammals)

      • Brain regions (hippocampus)

      • Small intestine

    • Comparative analysis across tissues to identify tissue-specific regulation patterns

  • Mechanistic experiments:

    • Circadian gene knockdown/knockout effects on ABHD13 expression

    • Analysis of ABHD13 expression in constant conditions (free-running)

    • Phase-shifting experiments to assess entrainment properties

  • Data analysis approaches:

    • Cosinor analysis to determine amplitude, phase, and period

    • JTK_CYCLE or RAIN algorithms for robust detection of rhythmicity

    • System biology approaches to integrate ABHD13 into known circadian networks

This comprehensive approach will help determine whether chicken ABHD13 is under circadian control and identify the mechanisms involved, providing insights into both temporal regulation of lipid metabolism and potential chronotherapeutic approaches for ABHD13-related disorders.

How can interspecies comparative analysis enhance our understanding of ABHD13 function?

Comparative analysis of ABHD13 across species can reveal evolutionarily conserved functions and species-specific adaptations. For chicken ABHD13 research, this approach offers valuable insights:

  • Phylogenetic analysis framework:

    • Sequence comparison across diverse species (mammals, birds, reptiles, fish)

    • Identification of:

      • Highly conserved regions indicating essential functions

      • Variable regions suggesting species-specific adaptations

      • Selection pressure analysis (dN/dS ratios)

    • Construction of evolutionary trees to understand ABHD13 evolution

  • Structural comparative analysis:

    • Homology modeling of chicken ABHD13 based on available crystal structures of related proteins

    • Comparison of predicted catalytic sites across species

    • Analysis of species-specific insertions/deletions and their structural implications

    • In silico docking studies with potential substrates across species variants

  • Functional comparative experiments:

    • Cross-species complementation assays:

      • Can human ABHD13 replace chicken ABHD13 function in chicken cells?

      • Are there species-specific substrate preferences?

    • Chimeric protein analysis:

      • Swapping domains between species to identify functional regions

      • Assessing enzyme kinetics of chimeric proteins

    • Expression pattern comparison:

      • Tissue distribution comparison across species

      • Developmental expression profiling

      • Response to environmental stimuli across species

  • Data integration and analysis:

    • Creation of comparative expression databases

    • Machine learning approaches to identify patterns in cross-species data

    • Network analysis of ABHD13 interactions across species

SpeciesABHD13 LengthTissue with Highest ExpressionKnown Interacting ProteinsConservation of Catalytic Triad
Human337 aaBrain (hippocampus)Multiple (see literature)Complete
Mouse337 aaTestes, small intestinePDE3B pathway proteinsComplete
ChickenVariableNot fully characterizedyrrOPredicted complete
ZebrafishAvailable commerciallyNot characterizedNot characterizedPredicted complete

This comparative approach not only enhances our understanding of chicken ABHD13 but also provides evolutionary context for its function, potentially revealing novel aspects of lipid metabolism regulation across vertebrate species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.