Recombinant Chicken Acyl-CoA-binding domain-containing protein 5 (ACBD5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ACBD5; RCJMB04_34h15; Acyl-CoA-binding domain-containing protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Gallus gallus (Chicken)
Target Names
ACBD5
Target Protein Sequence
MAETGSVHATRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATQGPCNIPRPGFWDP IGRYKWDAWSALGDMSKEEAMIAYVEEMKKILESMPMTDKVEELLQVIGPFYEIVEDKKN RGSGLTSDLSNVMNSTPNIKAVNGKAESSDSGAESEEEGLREEEEKELQQNVKDCKSPKT ESLAAKDLENSVANDCYKDSFIPDMQNGIQTKSALNGLNVEEEIKKTEPSLEIANNCDHR GANEENTEEVSGTQHLTSDSDSEVYCDSMEQLGLEEPLEIITSAKGSLKRSSHFLDVDHR LQLENTDLPRHACTTAGNLQLGTAVDGAVQEKGEVKCGGEDGKASNGAPHKEKKDGEKAD FYGVRRGRGHRLHPVGDGSQGGQMGNGGDGERWGSDRGPRGSLNEQIAVVLMRLQEDMQN VLQRLHMLEAVTASQARSATLQSNYQPASSVKKPSWWPFEISPGVLAFAIVWPFIAQWLV HVYLQRKRRKLN
Uniprot No.

Target Background

Function

Acyl-CoA binding protein functioning as the peroxisome receptor for pexophagy; however, it is not essential for aggrephagy or nonselective autophagy. It binds medium- and long-chain acyl-CoA esters.

Database Links
Protein Families
ATG37 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is Recombinant Chicken ACBD5 and what are its key features?

Recombinant Chicken ACBD5 is a full-length protein (492 amino acids) that contains an acyl-CoA-binding domain. The commercially available recombinant protein is typically expressed in E. coli with an N-terminal His-tag to facilitate purification . The protein has multiple functional domains including the acyl-CoA binding region and several protein interaction motifs that facilitate its biological functions in lipid metabolism and cellular signaling pathways.

The key features of Recombinant Chicken ACBD5 include:

  • Full amino acid sequence (492 amino acids)

  • N-terminal His-tag for purification purposes

  • Greater than 90% purity as determined by SDS-PAGE

  • Typically supplied as a lyophilized powder

  • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

How does Chicken ACBD5 differ from Human ACBD5?

While both proteins share the same core function, there are notable differences between Chicken and Human ACBD5:

FeatureChicken ACBD5Human ACBD5
UniProt IDQ5ZHQ6Q5T8D3
Length492 amino acids534 amino acids
Expression SystemE. coliE. coli
Sequence SimilarityReferenceApproximately 65-70% identity
Key DomainsAcyl-CoA binding domainAcyl-CoA binding domain plus additional regions

Human ACBD5 contains additional amino acid sequences not present in the chicken ortholog, particularly in regions involved in protein-protein interactions. Despite these differences, the core acyl-CoA binding domain shows high conservation, suggesting functional similarity across species .

What statistical considerations are important when designing experiments with Chicken ACBD5?

When designing experiments using Recombinant Chicken ACBD5, researchers should consider the following statistical parameters:

  • Sample size determination: Based on principles from broiler chicken studies, researchers should consider both biological and technical variation. A nested design approach is recommended for analyzing protein activity across multiple samples .

  • Power analysis: For detecting subtle differences in protein activity or expression, researchers should perform power analyses similar to those used in poultry research. With 5 replicate samples per treatment, increasing technical replicates from 2 to 4 can decrease standard deviation from 183 to 154, significantly improving experimental sensitivity .

  • Variance components: Consider both between-sample and within-sample variance. In protein studies, much like in broiler experiments, increasing technical replicates beyond 3-4 per sample yields diminishing returns in reducing standard deviation .

When designing experiments, remember that detecting small differences (1-3%) consistently in protein activity requires careful consideration of sample sizes and replication strategy. The principle of diminishing returns applies to both increasing biological samples and technical replicates .

How should I optimize experimental conditions for functional studies of Chicken ACBD5?

To optimize experimental conditions for functional studies of Chicken ACBD5:

  • Buffer selection: Use Tris/PBS-based buffer at pH 8.0 as recommended for maintaining protein stability .

  • Temperature conditions: Perform binding assays at physiologically relevant temperatures (37-40°C for avian proteins) to mimic in vivo conditions.

  • Protein concentration: Reconstitute protein to 0.1-1.0 mg/mL in deionized sterile water as recommended by manufacturers .

  • Storage stability: Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage at -20°C/-80°C .

  • Avoiding degradation: Limit freeze-thaw cycles as repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .

For binding studies, it's crucial to include both positive and negative controls to validate specific interactions and eliminate false positives that may arise from non-specific binding to the His-tag or other protein regions.

What expression systems are optimal for producing functional Chicken ACBD5?

The most commonly used and effective expression system for producing functional Chicken ACBD5 is E. coli, as demonstrated in commercial preparations . The protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography.

When expressing Chicken ACBD5 in E. coli:

  • Vector selection: pET-based vectors (such as pET28a) have proven effective for high-level expression .

  • E. coli strain: BL21(DE3) or Rosetta strains are recommended for optimal expression.

  • Induction conditions: IPTG concentration and induction temperature significantly impact yield and solubility. Lower temperatures (16-20°C) often improve protein folding.

  • Lysis conditions: Mechanical disruption (sonication or French press) in a Tris-based buffer containing protease inhibitors is recommended.

For mammalian studies requiring post-translational modifications, alternative expression systems such as HEK293 or CHO cells may be considered, though yields are typically lower than in bacterial systems.

What purification strategies yield the highest purity of Recombinant Chicken ACBD5?

A multi-step purification process is recommended to achieve >90% purity for Recombinant Chicken ACBD5:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-based resins to capture the His-tagged protein.

  • Intermediate purification: Ion exchange chromatography (typically anion exchange) to remove contaminants with different charge properties.

  • Polishing step: Size exclusion chromatography to separate monomeric protein from aggregates and remove remaining impurities.

  • Quality control: SDS-PAGE analysis to confirm >90% purity, followed by Western blotting or mass spectrometry for identity confirmation .

For studies requiring extremely high purity, consider additional purification steps or specialized techniques such as affinity tag removal using specific proteases (TEV or thrombin) followed by a second IMAC step to separate the cleaved protein from uncleaved material.

What methodologies can be used to assess ACBD5 binding to acyl-CoA molecules?

Several methodologies can be employed to assess the binding of Chicken ACBD5 to acyl-CoA molecules:

  • Isothermal Titration Calorimetry (ITC): This provides thermodynamic parameters (KD, ΔH, ΔS) of binding. Typically requires 0.2-0.5 mg of purified protein per experiment.

  • Surface Plasmon Resonance (SPR): Allows real-time analysis of binding kinetics and determination of kon and koff rates. His-tagged ACBD5 can be immobilized on NTA sensor chips.

  • Fluorescence-based assays: Using either intrinsic tryptophan fluorescence or environmentally sensitive fluorescent acyl-CoA analogs to monitor binding.

  • Pull-down assays: Immobilize acyl-CoA on appropriate matrices and assess binding of ACBD5, followed by Western blot detection.

  • Co-sedimentation assays: Particularly useful for assessing binding to membrane-associated acyl-CoA substrates.

For quantitative binding studies, it's essential to include appropriate controls and to perform experiments across a range of acyl-CoA chain lengths to establish binding specificity and affinity profiles.

How can interdomain interactions in ACBD5 be studied?

Based on methodologies used in fatty acid synthase research, interdomain interactions in ACBD5 can be studied using several approaches:

  • Yeast two-hybrid system: This system has been successfully used to study interdomain interactions in fatty acid synthases and can be adapted for ACBD5 research. Specific domains can be cloned into appropriate vectors (e.g., pAS2, pACT2) to express fusion proteins with DNA-binding and activation domains .

  • Co-immunoprecipitation: Using domain-specific antibodies to pull down interactions between different regions of the protein.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry to identify interacting regions.

  • Limited proteolysis: To identify domain boundaries and stable structural elements.

  • Deletion constructs: Creating truncated versions of the protein to determine which regions are essential for function and inter-domain communication.

These methodologies can help determine how different domains in ACBD5 interact to facilitate its function in lipid metabolism and peroxisomal targeting. The importance of interdomain interactions has been demonstrated in fatty acid synthase studies, where they play crucial roles in dimerization and active center formation .

What can we learn from human ACBD5-related disorders for basic research with Chicken ACBD5?

Human ACBD5 deficiency is associated with retinal dystrophy and leukodystrophy, providing important insights that can be applied to basic chicken ACBD5 research:

  • Functional conservation: The pathological manifestations in humans suggest that ACBD5 plays critical roles in retinal function and white matter maintenance, which may be conserved in avian species .

  • Disease mechanisms: Human patients with ACBD5 deficiency present with early vision loss, nystagmus, photophobia, and neurological symptoms including spasticity and learning disabilities . These phenotypes suggest that ACBD5 is crucial for both neural development and lipid homeostasis in specialized tissues.

  • Experimental models: Creating knockout or knockdown models of ACBD5 in chicken cells could provide valuable insights into the conserved functions across species.

  • Biochemical pathways: Studies in human patients reveal that ACBD5 deficiency leads to abnormal fatty acid metabolism, suggesting that the protein plays a similar role in chickens.

The clinical features associated with ACBD5 deficiency in humans (vision loss, spasticity, growth parameters below normal range) highlight the importance of this protein in normal development and function, providing valuable direction for chicken ACBD5 research .

How might ACBD5 function in metabolic pathways across different tissues?

ACBD5 likely functions in metabolic pathways through its acyl-CoA binding capabilities across various tissues:

  • Fatty acid metabolism: Similar to human fatty acid synthase (FAS), ACBD5 likely plays a role in fatty acid metabolism by binding and shuttling acyl-CoA molecules to appropriate enzymatic complexes .

  • Peroxisomal functions: ACBD5 is involved in very long-chain fatty acid metabolism in peroxisomes, which is critical for membrane lipid composition, especially in neural tissues.

  • Tissue-specific roles:

    • Retina: Critical for photoreceptor membrane maintenance and turnover

    • Neural tissue: Essential for myelin formation and maintenance

    • Liver and adipose tissue: Involved in systemic lipid metabolism

  • Cross-talk with other metabolic pathways: ACBD5 may facilitate communication between different lipid metabolism pathways, serving as a regulatory node.

In human studies, interdomain interactions between protein regions have been shown to be essential for the formation of active enzymatic complexes in fatty acid synthesis , suggesting that ACBD5 may function through similar mechanisms in creating functional complexes for lipid metabolism.

How can protein engineering be applied to enhance Chicken ACBD5 for research purposes?

Protein engineering strategies can be employed to enhance Chicken ACBD5 for various research applications:

  • Affinity tag optimization: While His-tags are commonly used , alternative tags (FLAG, GST, MBP) can be strategically placed to improve solubility or facilitate specific applications without compromising function.

  • Fluorescent protein fusions: Creating ACBD5-GFP or other fluorescent protein fusions enables real-time visualization of subcellular localization and trafficking.

  • Domain-specific mutations: Introducing specific mutations in the acyl-CoA binding domain can create variants with altered substrate specificity or binding affinity, useful for structure-function studies.

  • Stability engineering: Introducing disulfide bonds or optimizing salt bridges can enhance thermal stability for applications requiring robust protein preparations.

  • Cleavable linkers: Incorporating TEV or thrombin cleavage sites between domains allows selective removal of tags or separation of functional regions.

When designing engineered variants, it's crucial to validate that modifications don't disrupt the native protein folding or function. Comparative activity assays between wild-type and engineered variants should be conducted to ensure functional integrity is maintained.

What emerging technologies are most promising for studying ACBD5 interaction networks?

Several cutting-edge technologies show particular promise for elucidating ACBD5 interaction networks:

  • Proximity labeling techniques: BioID or APEX2 fusions to ACBD5 allow identification of proximal proteins in living cells, revealing the dynamic interactome in different cellular compartments.

  • CRISPR-based screening: Using CRISPR activation or interference libraries to identify genes that modulate ACBD5 function or expression.

  • Single-molecule imaging: Techniques like PALM or STORM microscopy can reveal the dynamics of individual ACBD5 molecules and their interactions with partner proteins or membranes.

  • Protein correlation profiling: Mass spectrometry-based approaches to identify proteins that co-fractionate with ACBD5 across different cellular conditions.

  • AlphaFold2 and molecular dynamics simulations: Computational approaches to predict protein structures and simulate interactions between ACBD5 and potential binding partners.

These technologies, when applied systematically, can provide unprecedented insights into how ACBD5 functions within broader protein networks and metabolic pathways, particularly in the context of fatty acid metabolism and peroxisomal functions.

What are the most promising future research directions for Chicken ACBD5?

The study of Chicken ACBD5 presents several promising research avenues:

  • Comparative functional studies: Systematic comparison between chicken and human ACBD5 to identify conserved and divergent functions, which could reveal fundamental aspects of acyl-CoA metabolism across species.

  • Developmental biology applications: Investigating the role of ACBD5 in chicken embryonic development, particularly in tissues affected in human ACBD5 deficiency such as retina and neural tissues .

  • Metabolic regulation: Exploring how ACBD5 regulates lipid metabolism in different physiological states (feeding, fasting, disease) in avian models.

  • Structure-based drug design: Using the structural information of Chicken ACBD5 to design molecules that could modulate its activity for research or potential therapeutic applications.

  • Integration with systems biology: Positioning ACBD5 within larger metabolic networks to understand its role in coordinating lipid metabolism across different cellular compartments.

These research directions can benefit from experimental design considerations highlighted in broiler chicken studies, where appropriate statistical power and sample sizes are critical for detecting biologically meaningful differences .

How can interdisciplinary approaches advance our understanding of ACBD5 biology?

Interdisciplinary approaches combining multiple techniques and perspectives can significantly advance ACBD5 research:

  • Integrated structural biology: Combining X-ray crystallography, cryo-EM, and NMR to elucidate the complete structure of ACBD5, including flexible regions not easily captured by a single technique.

  • Computational biology and experimental validation: Using predictions from AlphaFold2 or other computational tools to guide targeted experimental studies of protein-protein or protein-lipid interactions.

  • Metabolomics and proteomics integration: Combining changes in the lipidome and proteome in response to ACBD5 manipulation to build comprehensive models of its functional impact.

  • Clinical and basic research collaboration: Translating findings from human ACBD5 deficiency to guide basic research questions in chicken models, and vice versa.

  • Agricultural science and molecular biology: Connecting ACBD5 function to practical aspects of poultry science, potentially impacting animal health and production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.